KEGG   Modestobacter marinus: MODMU_0626Help
Entry
MODMU_0626        CDS       T02167                                 

Gene name
chlD
Definition
Cobaltochelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mmar  Modestobacter marinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mmar00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(632712..634775)
Genome map
AA seq 687 aa AA seqDB search
MTYPFGAVVGMDDMRLALLLNAVSPAVGGVLVRGEKGTAKSTTVRALSAVLPPVTVVAGC
RFACDPAAPDPGCPDGPHDPGTPSVTRAARLVELPVGASEDRLVGSLDLERALTEGVKSF
EPGLLAGAHRGVLYVDEVNLLHDHLVDLLLDAAALGRAYVEREGVSVQHAARFLLVGTMN
PEEGELRPQLLDRFGLTVEVAAPRDADLRAEVVRRRFAHDADPAGFAATWAADEAALAAR
IAGARERLPQVVLSDAALRQVTSVCAAFDVDGLRADIVTARAAIAHAAWCGRTDVTEDDV
RVAARLALPHRRRRNPFDAPGLDEDTLDQALADSRPDEPDDDPEPPTDGGPGGPDGGGGT
PPPSGDAGKGTNTGGSEAETQVKEPMPADDEGPTTAPRGEGGGHTEAAPAPEKAAVAPDS
PFRVQRLEVPGIGAGAAGRRSRARSERGRVVGSRRPDGPVTRLHLVDTVLAAAPHQRARG
RSGTGLRVQREDLRQASLEGREGNLVLFVVDASGSMGARSRMAAVKGAVLSLLLDAYQRR
DKVGLITFRGGEAELALPPTWSVEAAAARLTGLPTGGRTPLAAGLLRAHETLRLERVRDP
HRRPLLVVVTDGRATGARGTDSLGESRRAAALLAATGVAGVVVDCESGPVRLGLAASLGL
QLGAQILRLEELGAEQLAGVVRERRAA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
gtgacctacccgttcggcgccgtcgtcggcatggacgacatgcggctcgccctcctgctc
aacgccgtctcgcccgccgtcggcggtgtgctggtccgcggggagaaggggacggcgaag
tccaccaccgtgcgggcgctgtccgccgtcctcccgccggtcaccgtcgtcgccggctgc
cggttcgcctgcgaccccgccgcacccgaccccggctgccccgacggcccgcacgacccc
ggcaccccgtcggtcacccgggccgcccggctggtcgagctcccggtcggcgcctcggag
gaccggctggtcggctcgctggacctggagcgcgcgctcaccgagggcgtgaagtccttc
gagcccggactgctcgccggcgcccaccgcggcgtgctgtacgtcgacgaggtcaacctg
ctgcacgaccacctggtcgacctgctcctcgacgccgccgcgctcggccgcgcctacgtc
gagcgggagggcgtctcggtgcagcacgccgcccggttcctgctggtcggcacgatgaac
cccgaggagggcgagctccgcccccagttgctggaccgcttcggcctcaccgtcgaggtg
gccgccccgcgggacgccgacctccgcgccgaggtggtgcgccgccgcttcgcccacgac
gccgacccggccggcttcgccgcgacctgggccgccgacgaggccgcgctggccgcccgg
atcgccggggcgcgggaacggctgccgcaggtcgtcctctccgacgcggcgctgcgccag
gtcaccagcgtctgcgccgccttcgacgtcgacgggctgcgcgccgacatcgtgaccgcc
cgcgccgccatcgcgcacgccgcctggtgcggccgcaccgacgtcaccgaggacgacgtc
cgggtcgccgcccggctggccctgccgcaccgccgccgccgcaaccccttcgacgccccc
ggcctggacgaggacaccctggaccaggccctcgccgactcccgccccgacgagcccgac
gacgaccccgaacccccgaccgacggcggccccggcggccccgacggtggcggcggcact
cccccgccgtccggcgacgcaggtaaaggaaccaataccggcggatccgaggccgaaacg
caggtaaaggaacctatgcccgcggacgacgaggggccgacgacggcgccgcgcggtgag
ggcggtgggcacaccgaggccgcgcccgcgccggagaaggcggccgtcgcccccgactcg
ccgttccgcgtgcagcgcctggaggtgcccggcatcggcgcgggcgcggccgggcgccgg
tcccgggcgcgcagcgagcgcggccgggtggtcggctcgcggcgccccgacggcccggtc
acccggctgcacctggtcgacaccgtgctcgccgccgcaccgcaccagcgggcgcgcggc
cgcagcggcaccgggctgcgcgtccagcgcgaggacctgcgccaggcctcgctcgagggc
cgcgagggcaacctggtgctcttcgtcgtcgacgccagcggctcgatgggcgcccgctcg
cgcatggccgcggtgaagggcgccgtcctctccctgctgctggacgcctaccagcggcgg
gacaaggtcgggctgatcaccttccgcggcggcgaggccgagctggccctgccgcccacc
tggtcggtcgaggcggccgccgcccggctcaccggcctgcccaccggcggccggacaccg
ctggccgccgggctgctgcgcgcccacgagaccctgcggctggaacgggtccgcgatccg
caccgccggccgctgctcgtcgtcgtcaccgacgggcgggccaccggcgcccgcggcacc
gactccctcggcgagtcccggcgcgcggcggcactgctggcggccacgggggtggccggt
gtcgtcgtcgactgcgagtccggcccggtgcggctgggcctggcggcgtccctgggtctc
cagctcggcgcgcagatcctgcgcctggaggagctgggcgcggagcagctggccggcgtc
gtccgggaacggcgggcggcctga

DBGET integrated database retrieval system