KEGG   Modestobacter marinus: MODMU_0727Help
Entry
MODMU_0727        CDS       T02167                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mmar  Modestobacter marinus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmar00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
727385..728056
Genome map
AA seq 223 aa AA seqDB search
MSAAPGGARESAAGQVDGAGLDPRTGDPVADLPEGRFDAGRIEAAVREILAAIGEDPDRP
GLQDTPARVARAYAESFAGLAQDPADALATTFDEGHEELVLVKDIAMYSTCEHHLVPFHG
VAHVGYIPGYDGRVTGLSKLARLVEVYARRPQVQERMTRQIADSLYDVLKPRGVIVVIEA
EHLCMAMRGVRKPGTRTMTSAVRGIFRENAATRSEAMSLILGR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcaccggggggagcacgcgagagcgcggccggccaggtcgacggtgcgggg
ctggacccgcgcaccggcgacccggtcgccgacctccccgaggggcggttcgacgccggg
cggatcgaggccgccgtgcgggagatcctggccgcgatcggcgaggaccccgaccgcccg
ggcctgcaggacacccccgcccgggtcgcccgcgcctacgcggagagcttcgccgggctg
gcccaggacccggccgacgccctcgccaccaccttcgacgagggccacgaggagctggtg
ctggtcaaggacatcgcgatgtactcgacctgcgagcaccacctggtgcccttccacggc
gtcgcgcacgtcgggtacatccccgggtacgacggccgggtcaccggtctgtcgaagctg
gcccggctggtcgaggtctacgcccgccgcccgcaggtgcaggagcggatgacccggcag
atcgccgactcgctgtacgacgtgctcaagccgcgcggagtcatcgtggtcatcgaggcc
gagcacctgtgcatggcgatgcgcggcgtccgcaagccggggacgcggacgatgacctcg
gccgtgcgcgggatcttccgggagaacgccgccacccgcagcgaggccatgagcctcatc
ctgggccggtga

DBGET integrated database retrieval system