KEGG   Modestobacter marinus: MODMU_0730Help
Entry
MODMU_0730        CDS       T02167                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase (7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) (HPPK) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (PPPK) (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mmar  Modestobacter marinus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmar00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
729286..729789
Genome map
AA seq 167 aa AA seqDB search
MTRAVLSLGGNLGDRAGTLRAALVALTGHGLVARSTLYETPPWGPVEQPPYLNAVAVVRG
DRDAAGWLALAHELEQAAGRTREVRWGARTLDVDVVTVTGDDGAPVLSADPELTLPHPRA
HERAFVLVPWLSLDPAATLPGHGRVADLVAALPADEVAAVTRWEQLA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgcggtcctctcgctcggcgggaacctgggcgaccgcgcgggcacgctgcgc
gccgccctggtcgcgctcaccggccacgggctggtcgcccgctcgacgctgtacgagacc
ccgccctggggcccggtcgagcagccgccgtacctgaacgccgtcgccgtcgtccggggc
gaccgggacgccgccggctggctggcgctcgcccacgagctggagcaggccgccgggcgc
acccgggaggtgcgctggggcgcgcggacgctggacgtcgacgtcgtcaccgtcaccggg
gacgacggcgcacccgtgctgtcggccgacccggagctgaccctgccgcacccgcgggcg
cacgagcgggcgttcgtgctcgtcccgtggctgtccctggacccggcggcgacgctgccc
gggcacggccgcgtcgccgacctggtggccgcgctgccggccgacgaggtggccgcggtc
acccggtgggagcagctggcatga

DBGET integrated database retrieval system