KEGG   Modestobacter marinus: MODMU_0780Help
Entry
MODMU_0780        CDS       T02167                                 

Gene name
thrC
Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmar  Modestobacter marinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MODMU_0780 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MODMU_0780 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MODMU_0780 (thrC)
Enzymes [BR:mmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MODMU_0780 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778342..779643
Genome map
AA seq 433 aa AA seqDB search
MTMTAPGSAQADVTEGGPVPPNPARGLVCRNCGATFGLIAEHACAECFGPLEVDYDPEVM
RAVTRQQIEAGPQNIWRYAALLPVGHDPADRVTLDPGMTPLVRADRLAAELGITGGLWVK
DDSANPTHSFKDRVVSLAATAAKGFGYAKIACASTGNLANSVAAHAARMGLPSFVFVPSD
LEPGKIVQSAVYGQALIAVDGSYDDVNRLTSELAETDEFEDTAFVNQNVRPYYAEGSKTM
GYEIAEQLGWRIPAQVVIPMASGSLLTKVDKAWRELVAAGIVEDTGWKVFGAQSAGCDPI
ATAFDNGWDVVKPVKPTGIAKSLNIGNPADGPYALDAVRRTGGSVARVGDDEIVAGIRDL
ARTTGVFAETAGGVTTAVLRKLVEGGLLDPTLETVVLNTGEGLKTLDPLLDVVGPSHRVQ
PSLRSLREAGLIG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccgctcccggttccgcccaggcagacgtcaccgaaggcgggccggtccca
ccgaaccccgcccgcgggctggtctgccgcaactgcggcgccaccttcggcctcatcgcc
gagcacgcctgcgccgagtgcttcggcccgctggaggtcgactacgaccccgaggtcatg
cgtgcggtgacccgccagcagatcgaggccgggccgcagaacatctggcgctacgccgcg
ctgctgcccgtcggccacgacccggccgaccgggtcaccctcgacccgggcatgacgccg
ctggtgcgggccgaccggctggccgccgagctcggcatcaccggcgggctctgggtcaag
gacgactcggccaaccccacccactccttcaaggaccgggtggtcagcctggccgcgacc
gcggccaagggcttcggctacgccaagatcgcctgcgcctcgaccggcaacctggccaac
tccgtcgcggcgcacgccgcccggatggggctgccctccttcgtcttcgtccccagcgac
ctggagccgggcaagatcgtccagtccgcggtgtacgggcaggcgttgatcgccgtcgac
ggctcctacgacgacgtcaaccggctgaccagcgagctcgccgagaccgacgagttcgag
gacaccgccttcgtcaaccagaacgtccggccctactacgccgagggctccaagacgatg
ggctacgagatcgccgagcagctcggctggcggatcccggctcaggtggtcatcccgatg
gcgtcgggctcgctgctcaccaaggtcgacaaggcgtggcgcgagctggtcgccgcaggc
atcgtcgaggacaccggctggaaggtcttcggcgcccagtccgccggctgcgacccgatc
gccaccgcgttcgacaacggctgggacgtcgtgaagccggtcaagccgaccgggatcgcc
aagtcgctcaacatcggcaaccccgccgacggcccctacgcgctggacgccgtccggcgc
accggcgggtcggtcgcccgggtcggggacgacgagatcgtcgccggcatccgcgacctg
gcccgcacgaccggcgtcttcgccgagacggcaggcggggtcaccaccgcggtgctgcgc
aagctggtcgagggcgggctgctcgacccgacgctggagaccgtcgtgctgaacaccggt
gagggcctcaagaccctcgacccgctgctcgacgtcgtcggcccctcgcaccgggtccag
ccctcgctgcggtcgctgcgcgaggccggtctcatcggctga

DBGET integrated database retrieval system