KEGG   Modestobacter marinus: MODMU_0932Help
Entry
MODMU_0932        CDS       T02167                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmar  Modestobacter marinus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MODMU_0932 (gtaB)
   00052 Galactose metabolism
    MODMU_0932 (gtaB)
   00500 Starch and sucrose metabolism
    MODMU_0932 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MODMU_0932 (gtaB)
Enzymes [BR:mmar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MODMU_0932 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928563..929507
Genome map
AA seq 314 aa AA seqDB search
MSSPSTPSQRTATKAVIPVAGMGTRFLPATKAVPKELLPVVDRPALQYIVEEAARAGLPE
VLMVTGRNKGSIEDFFDRTPELETALEAKGDQSRLDAVHASTDVAQVHFVRQGEAKGLGH
AVLQAAAFVGDEPFAVLLGDDIIDARDLLLEQMLAVQAEHGGAVVALLDVGAENISKYGA
VAVEEAKVSGDAAGDEVFRITGMVEKPPADEAPSSLAIIGRYVLPPEVFAAIRETPPGRG
GEIQLTDAMLKLVDDGVPVHGVVFSGRRYDTGDKLDYLKAVVQLAVEREDLGPAFAPWLR
DFVADLPVEGASPA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcccgtccaccccgagccagcgcacggccaccaaggccgtcatccccgttgcc
gggatggggacccgcttcctccccgccaccaaggcggtgcccaaggagctgctgccggtc
gtcgaccggccggcgctgcagtacatcgtggaggaggcggcgcgcgccggcctgcccgag
gtgctcatggtcaccggccgcaacaagggcagcatcgaggacttcttcgaccgcaccccg
gagctcgagacggcgctggaggccaagggcgaccagtcgcggctggacgcggtgcacgcc
tccaccgacgtcgcccaggtgcacttcgtccgccagggcgaggccaaggggctgggccac
gcggtgctgcaggccgccgcgttcgtgggcgacgagccgttcgcggtgctcctcggcgac
gacatcatcgacgcccgcgacctgctgctggagcagatgctcgccgtccaggccgagcac
ggcggtgcggtcgtggcgctgctcgacgtgggtgcggagaacatctccaagtacggcgcg
gtcgccgtcgaggaggccaaggtctccggcgacgccgccggtgacgaggtcttccggatc
accggcatggtcgagaagcccccggccgacgaagcccccagctcgctggcgatcatcggc
cgctacgtgctccccccggaggtcttcgccgcgatccgggagaccccgcccggccgcggc
ggggagatccagctgaccgacgccatgctcaagctggtcgacgacggcgtgcccgtgcac
ggcgtcgtcttctccggtcgccgctacgacaccggcgacaagctcgactacctcaaggcc
gtcgtccagctcgccgtcgagcgggaggacctgggccccgcgttcgccccctggttgcgt
gacttcgtcgcggacctgcccgtcgagggcgcgtcgccggcctga

DBGET integrated database retrieval system