KEGG   Modestobacter marinus: MODMU_0951Help
Entry
MODMU_0951        CDS       T02167                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mmar  Modestobacter marinus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MODMU_0951 (ispE)
Enzymes [BR:mmar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MODMU_0951 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
951646..952614
Genome map
AA seq 322 aa AA seqDB search
MRNATSGGPGRLAGNGAVAARAPAKVNVHLGVGKLRPDGYHELQTVYLAVSLFDTVTVRR
AEGLSLTVRGEGAGDGRGPSSVPLDRRNLVWQAAELLARHAGISADADLEIDKTIPAAAG
LAGGSADAAAALVALDALWGTRATRGDLATLAAQLGSDVPFSLLGGVALGTHRGERLSPV
LARRRWDWVLGIAGDGLSTPAVYAELDEMRAAGTLPDGAELASTEPVIAALRSGPTQALA
AALSNDLQPPAIRLRPELRRALRATSDAGARAALVSGSGPTVAGLADDEDTAVRLAAELA
GAGVFRTVRAVHGPVHGARLVG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaacgcgacgtccggtggacccggcaggctggccggcaacggcgccgtcgccgcg
cgggcaccggcgaaggtcaacgtgcacctgggcgtcgggaagctgcgcccggacggctac
cacgagctgcagacggtgtacctcgccgtctcgctgttcgacacggtcaccgtgcggcgc
gccgaggggctctcgctcaccgtccgcggtgagggtgccggcgacggccgcggcccgtcg
agcgtgccgctggaccggcggaacctggtctggcaggccgcggagctgctggcccggcac
gcgggcatctcggccgacgcggacctggagatcgacaagacgatcccggccgccgccggg
ctggccgggggcagcgcggacgccgccgcggcgctggtcgccctggacgccctctggggc
acccgggccacccgcggcgacctcgccacgctcgccgcgcagctgggcagcgacgtgccg
ttcagcctgctcggcggggtcgccctgggcacccaccgcggcgagcggttgtccccggtg
ctggcccgccggcggtgggactgggtgctgggcatcgccggggacgggttgtcgaccccg
gccgtctacgccgagctcgacgagatgcgggcggccgggacgctgcccgacggtgcggag
ctggcctcgaccgagccggtcatcgccgcgctgcgcagcggaccgacgcaggcgctggcg
gccgcgctcagcaacgacctgcagcccccggcgatccggctgcgcccggagctgcgccgg
gcgctgcgggccacctcggacgccggtgcgcgcgccgcgctggtcagcgggtcggggccg
accgtggccgggctggccgacgacgaggacaccgccgtgcggctggccgccgagctcgcc
ggcgccggcgtcttccggacggtccgtgcggtgcacgggccggtgcacggggcccggctc
gtcggctga

DBGET integrated database retrieval system