KEGG   Modestobacter marinus: MODMU_0987Help
Entry
MODMU_0987        CDS       T02167                                 

Definition
Mg-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mmar  Modestobacter marinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MODMU_0987
Enzymes [BR:mmar01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MODMU_0987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(993612..995087)
Genome map
AA seq 491 aa AA seqDB search
MVEVTDAAPLGTSQSPTPPPPTTLGELRDSGAAPRPVKAEIRDNLLARLAAGEPSLPGIV
GFEDTVVPEVERALIAGHDLVLLGERGQGKTRLIRTLVGLLDEWTPVLVGSELNEHPLQP
ISVWGRRQVAEHGDATPVGWLHRSERFGEKLATPDTSVGDLIGDVDPIKVAEGRTLGDPE
TVHYGLVPRTNRGIFSVNELPDLAERIQVALLNVLEERDIQIRGYRVRLPLDLLLVASAN
PEDYTNRGRIITPLKDRFGAEVRTHYPIELADELRLLRQEAQTTWLGGTGFDAPIVPEHL
VEIVARFTRLVRESSHVDQRSGVSARFAIAGLETVAASAVRRAAVAGEPRPVARVVDLPS
IVPASRGKVEFADAGTDNDDDRDLEVLEHLLRQATAQTFRARCGGLDLTGLQEHFSSGET
VESGDLVPAAALLGQLGTIPHLAQLLGRLGVPEGEQSAEQAAAAVEFALEGLYLTRRLAK
DTDGSRTVYGA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaggtgacggacgccgcaccgctggggacctcgcagtcccccacccctcctcct
cccaccaccctgggcgagctccgcgacagcggggccgccccccggccggtcaaggccgag
atccgcgacaacctgctcgcccggctggccgccggcgagccctccctccccggaatcgtc
ggtttcgaggacaccgtcgtccccgaggtcgagcgcgccctgatcgccgggcacgacctg
gtcctgctcggtgagcgcggccagggcaagacccggctcatccgcaccctggtcggcctg
ctcgacgagtggacgccggtgctggtcggcagcgagctcaacgagcacccgctgcagccg
atcagcgtctggggccggcggcaggtcgccgagcacggcgacgcgaccccggtcggctgg
ctgcaccgcagcgagcggttcggcgagaagctggccacccccgacaccagcgtcggtgac
ctgatcggcgacgtcgacccgatcaaggtggccgagggccgcaccctgggcgacccggag
accgtgcactacggcctcgtgccgcgcaccaaccgcggcatcttcagcgtcaacgagctg
cccgacctcgccgagcggatccaggtcgcgctgctcaacgtgctcgaggagcgcgacatc
cagatccgcggctaccgggtccggctcccgctggacctgctgctggtcgccagcgccaac
cccgaggactacaccaaccgcgggcggatcatcaccccgctcaaggaccggttcggcgcc
gaggtccgcacccactacccgatcgagctggccgacgagctccggctgctgcgccaggag
gcgcagaccacctggctcggcggtaccgggttcgacgccccgatcgtccccgagcacctg
gtcgagatcgtcgcccggttcacccggctggtccgcgagtccagccacgtcgaccagcgc
tccggggtcagcgcccggttcgccatcgccgggctggagacggtcgccgcctcggccgtc
cggcgggcggcggtggccggggagccccggccggtggcccgggtggtcgacctgcccagc
atcgtcccggccagccggggcaaggtcgagttcgccgacgccggcaccgacaacgacgac
gaccgcgacctcgaggtgctggagcacctgctgcggcaggccacggcgcagaccttccgg
gcccgctgcggcgggctggacctgaccggcctgcaggagcacttcagcagcggcgagacg
gtcgagtccggtgacctggtgccggcggcggcgctgctcggccagctgggcaccatcccg
cacctggcccagctgctgggccggctgggggtgcccgagggcgagcagtcggccgagcag
gccgccgcggccgtggagttcgccctcgaggggctgtacctcacccgccggctggccaag
gacacggacggctcccgcaccgtgtacggggcctga

DBGET integrated database retrieval system