KEGG   Modestobacter marinus: MODMU_1264Help
Entry
MODMU_1264        CDS       T02167                                 

Gene name
caiD
Definition
carnitinyl-CoA dehydratase (EC:4.2.1.-)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmar  Modestobacter marinus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MODMU_1264 (caiD)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MODMU_1264 (caiD)
   00650 Butanoate metabolism
    MODMU_1264 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    MODMU_1264 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MODMU_1264 (caiD)
   00310 Lysine degradation
    MODMU_1264 (caiD)
   00360 Phenylalanine metabolism
    MODMU_1264 (caiD)
   00380 Tryptophan metabolism
    MODMU_1264 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MODMU_1264 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MODMU_1264 (caiD)
   00281 Geraniol degradation
    MODMU_1264 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MODMU_1264 (caiD)
   00627 Aminobenzoate degradation
    MODMU_1264 (caiD)
   00930 Caprolactam degradation
    MODMU_1264 (caiD)
Enzymes [BR:mmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MODMU_1264 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1256455..1257219
Genome map
AA seq 254 aa AA seqDB search
MTGPVLTEVADGVGVLTLNRPEAKNAVDLATTEALAAALDEFDARDDVAVLVLTGAGGTF
CAGMDLKAFARGERPRIEGRGFAGLTEAPPAKPLIAAVEGWALAGGCELALSADLVVAAR
DARFGIPEVKRGLFAAGGGVLRLAKALPYQRAMEMALTGDPLPAEEAHRFGLVNVLTEPG
GALAGARELAARITVNGPLAVRASKQLVAGSVGWTDRAALDAQQELADRVFASADALEGA
RAFAEKRAPVWRGV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaccggtgctgaccgaggtggccgacggggtcggggtgctgaccctcaaccgg
ccggaggcgaagaacgccgtcgacctggcgaccaccgaggcgctggccgccgcgctggac
gagttcgacgcgcgcgacgacgtcgccgtcctggtgctcaccggcgccgggggcacgttc
tgcgccgggatggacctcaaggccttcgcccgcggcgagcggccgcggatcgagggccgc
gggttcgccgggctcaccgaggcgccgccggccaagccgctgatcgccgccgtcgagggc
tgggcgctggccggcggctgcgagctggcgctgtccgccgacctggtcgtcgccgcccgg
gacgcccggttcggcatcccggaggtcaagcgcggcctgttcgccgccggcggcggggtg
ctacggctggccaaggcgctgccctaccagcgcgcgatggagatggcgctcaccggcgac
ccgctgccggccgaggaggcgcaccggttcggcctggtcaacgtgctcaccgagcccggc
ggcgcgctggccggcgcccgggagctggccgcccggatcaccgtgaacgggccgctggcg
gtgcgggccagcaagcagctcgtcgccgggtcggtcggctggaccgaccgcgcggccctc
gacgcgcagcaggagctcgccgaccgcgtcttcgcctccgccgacgccctcgagggtgcc
cgggccttcgccgagaagcgcgccccggtctggcgcggcgtctga

DBGET integrated database retrieval system