KEGG   Modestobacter marinus: MODMU_2005Help
Entry
MODMU_2005        CDS       T02167                                 

Gene name
fdh
Definition
formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mmar  Modestobacter marinus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mmar01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mmar00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mmar00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1963443..1964597
Genome map
AA seq 384 aa AA seqDB search
MKAVVYEGPRQVSVKDVPDARIERPTDVLVRITSANICGSDLHMYEGRTDFEPGRWFGHE
NLGQVIEVGDGVDKVQVGEYVVLPFNIACGHCKNCEQQLTNYCLTAQPKKEWAGAAYGFA
DMGPYGGGQAELLRVPWGDFNCLRLGEDAEQRQTDYVMLADIFPTGYHATELAGVKPGDQ
TVIYGAGPVGLMAALSATIRGASKVMVVDRHPDRLRLAESIGAIAIDDSKVDPVQAVLDQ
TMGLGADNGCECVGYQAHEPDGQEQANLTMNRLVASVRFTGKIGNVGVFVPQDPGASDEL
AKQGKLAFDYGMFWFKGQHIGSGQAPVKKYNRQLRDLIAAGKAEPSFIVSHELPLERAPE
AYEHFDKRDEGWTKVVLHPAMAGS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcgtgtacgaggggccgcgccaggtcagcgtcaaggacgtaccggacgca
cggatcgagcggccgaccgacgtgctggtgcggatcacctcggcgaacatctgcggctcg
gacctgcacatgtacgagggccggaccgacttcgagcccggccgctggttcgggcacgag
aacctgggccaggtgatcgaggtcggggacggggtcgacaaggtgcaggtgggggagtac
gtcgtcctgccgttcaacatcgcctgcgggcactgcaagaactgcgagcagcagctcacg
aactactgcctgaccgcgcagccgaagaaggagtgggccggcgccgcgtacggcttcgcc
gacatgggtccgtacggcgggggccaggccgagctgctgcgcgtgccctggggtgacttc
aactgcctgcggctgggtgaggacgccgagcagcgccagaccgactacgtgatgctcgcc
gacatcttcccgaccggctaccacgccaccgagctggccggcgtcaagccgggcgaccag
acggtcatctacggcgccggtccggtggggctgatggccgcgctgtcggcgaccatccgc
ggggccagcaaggtgatggtcgtcgaccggcaccccgaccggctgcggctggccgagtcg
atcggcgcgatcgcgatcgacgactcgaaggtcgacccggtgcaggccgtcctcgaccag
acgatggggctcggcgcggacaacggctgcgagtgcgtcggctaccaggcgcacgagccc
gacgggcaggagcaggccaacctgacgatgaaccggctggtcgcctcggtgcgcttcacc
gggaagatcggcaacgtcggcgtcttcgtgccccaggaccccggggccagcgacgagctg
gcgaagcagggcaagctcgccttcgactacggcatgttctggttcaagggccagcacatc
ggcagcggccaggccccggtcaagaagtacaaccggcagctgcgcgacctcatcgccgcg
ggcaaggccgagccgtcgttcatcgtgagccacgagctgcccctcgagcgggcgccggag
gcctacgagcacttcgacaagcgggacgagggctggaccaaggtcgtcctccacccggcg
atggcggggagctga

DBGET integrated database retrieval system