KEGG   Modestobacter marinus: MODMU_2246Help
Entry
MODMU_2246        CDS       T02167                                 

Definition
alcohol dehydrogenase (Zinc-containing) (AdhT-like) (EC:1.1.1.1)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
mmar  Modestobacter marinus
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MODMU_2246
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     MODMU_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2205859..2206887)
Genome map
AA seq 342 aa AA seqDB search
MKAVRVHEYGKPPSIDDVPDPELQGPLDVLVHVDAAGVCRTDLHIIEGQWAEASGVGLPY
VIGHENAGTVVEVGDAVRNVSVGDKVILHPLVTCGLCPPCRRGDDVHCENGEFPGISRDG
GMAELLRTNARSVVKLAEGLQPVDVAALADAGLTAQHAVRKAVPLLPATARAVVIGAGGL
GHIGLQCLLAMTPAEITVVDRSAEALAKAAELGAHRTVQAGDGTVAEVLDALGGTGAEVV
FDFVGEHGTEAEGIAMTRDTGSYYVIGYGGAVQVPTLEIINREISIVGNKVGSYTDLREL
MALAARGLVTLSTRTYPLTSALEALDDLDGGRLPGTRAILVP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccgtccgcgtgcacgagtacggcaagcccccgtcgatcgacgacgtcccggac
ccggagctgcagggcccgctcgacgtcctggtgcacgtcgacgccgccggggtgtgccgg
accgacctgcacatcatcgagggccagtgggccgaggccagcggcgtcgggctgccctac
gtgatcggccacgagaacgccggcaccgtcgtggaggtcggcgacgcggtgcgcaacgtg
tcggtcggcgacaaggtcatcctgcacccgctggtgacctgcgggctgtgcccgccctgc
cgccgcggcgacgacgtgcactgcgagaacggcgagttccccggcatcagccgggacggc
gggatggccgagctgctgcgcaccaacgcccggtcggtggtgaagctcgccgaggggctg
cagccggtggacgtcgcggcgctggcggacgccgggctcaccgcgcagcacgccgtccgc
aaggcggtgccgctgctgccggccaccgcccgggcggtggtgatcggcgcgggcggcctc
gggcacatcgggctgcagtgcctgctggcgatgaccccggccgagatcaccgtcgtcgac
cgctcggccgaggcgctggccaaggccgccgagctcggcgcgcaccggacggtccaggcc
ggggacggcacggtggcggaggtgctcgacgcgctgggcggcaccggcgcggaggtcgtc
ttcgacttcgtcggcgagcacggcaccgaggccgagggcatcgcgatgacccgggacacc
ggctcgtactacgtcatcggctacggcggcgcggtgcaggtgccgacgctggagatcatc
aaccgggagatcagcatcgtcggcaacaaggtcggctcctacaccgacctgcgcgagctg
atggcgctggcggcccgcggcctggtcacgctgtcgacgcggacctacccgctgacgtcg
gcgctggaggcgctcgacgacctcgacggcggccgcctcccgggcacccgggcgatcctg
gtcccctga

DBGET integrated database retrieval system