KEGG   Modestobacter marinus: MODMU_2580Help
Entry
MODMU_2580        CDS       T02167                                 

Definition
ATP-dependent exoDNAse subunit alpha/helicase superfamily I protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mmar  Modestobacter marinus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MODMU_2580
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MODMU_2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2540042..2541988)
Genome map
AA seq 648 aa AA seqDB search
MTSPTPDLVFAAFCTAGLWPGLGKRTAADLPAAGITTADDVSADRLQKLPRVGRQRAERL
FSSFLAAQPTYEVVELLVAAGLNARLAANSADALGPDAARRLRDDPWALLGLTGVTLADA
DRLAVNVLPGADRQDTRRGRAVVGLTLRTATRDGHTVLPADLVVAALRAEQIEDPEAAIV
AAVEGGDVLEHEPPFVEPDEDDPDAEFPEPDPALRMLSLARYGMAEEAVAENVHRLVATS
GRLADPASVRSVAKGLDPAQQAAVAGVLGAGVSLLTGGPGTGKSRTVASLVQLLQAKGTE
VALAAPTGRAAKRLEELTDHPAVTVHRLLGAQGTTGGFSRNEEWPLDADVVVVDEASMLD
VELTAALLEACKDGTHLLLVGDPAQLPSIGPGHVLGDLIDSGAVPVTELTMLHRQAAGGA
IARLATGVRGGELVQVESPDREVVIVPATGSAEAAKRVVQLVTDSIPRALGIDPATVQVV
TPVHRGPAGTIELNKALKEKLNPGTGTVFGFDVGDRVVATANHLDIEPIGFANGEVGVVT
GTGEGSLSIDFSSGPVTVTGSALSDLRHGWAITVHRAQGSEWPGVVVVLPPEAGGMLSRP
LVYTALTRAQKHLSIVHASGAALARAVREVDVRPRRTRLSGLLAELAD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagccccacccccgacctcgtcttcgccgccttctgcaccgccggtctgtggccg
gggctgggcaagcggacggccgccgacctgcccgccgccgggatcaccaccgccgacgac
gtctccgccgaccggctgcagaagctgccccgggtgggccggcagcgcgccgagcggctg
ttcagctccttcctggccgcgcagccgacctacgaggtcgtcgagctgctggtcgccgcc
gggctgaacgcccggctggccgcgaactccgccgacgcgctcggcccggacgccgcccgc
cggctgcgcgacgacccgtgggcgctgctggggctgaccggggtgacgctggccgacgcc
gaccggctggcggtcaacgtgctccccggcgccgaccggcaggacacccgccggggccgg
gccgtggtcgggctgaccctgcgcaccgccacccgggacgggcacaccgtgctgccggcc
gacctggtggtggcggcgctgcgggccgagcagatcgaggacccggaggcggcgatcgtg
gccgccgtcgagggcggtgacgtgctggagcacgagccgccgttcgtcgagcccgacgag
gacgacccggacgccgagttccccgagcccgaccccgcgctgcggatgctgtcgctggcc
cggtacgggatggccgaggaggccgtggcggagaacgtgcaccggctggtggccaccagc
gggcggctcgccgacccggcctcggtgcggtcggtggccaagggcctggacccggcccag
caggccgccgtcgccggggtgctcggcgcgggggtctcgctgctcaccggcggcccgggc
accggcaagagccgcaccgtggcctccctggtccagttgctgcaggccaagggcaccgag
gtggcgctggccgcccccaccggccgggcggccaagcggctcgaggagctcaccgatcac
ccggcggtgacggtgcaccggctgctgggcgcgcagggcaccaccggcgggttctcccgc
aacgaggagtggccgctggacgccgacgtcgtcgtggtcgacgaggcctcgatgctcgac
gtcgagctgaccgccgcgctgctggaggcgtgcaaggacggcacccacctgctgctggtc
ggcgaccccgcgcagctgccctccatcggccccggccacgtgctgggcgacctgatcgac
tccggcgccgtgccggtcaccgagctgaccatgctgcaccggcaggccgccggtggcgcg
atcgcccggctggccaccggcgtccggggcggggagctggtccaggtcgagtcccccgac
cgggaggtggtcatcgtgccggcgaccggcagcgcggaggccgccaagcgggtggtccag
ctggtgaccgactcgatcccgcgggcgctgggcatcgacccggcgacggtgcaggtcgtc
acgccggtgcaccgcgggccggcgggcacgatcgagctgaacaaggcgctgaaggagaag
ctgaacccgggcaccgggacggtgttcggcttcgacgtcggcgaccgggtggtggccacc
gccaaccacctggacatcgagccgatcggcttcgccaacggcgaggtcggggtggtcacc
ggcaccggcgaggggtcgctgagcatcgacttcagctccgggccggtgacggtgaccggc
tccgcgctgtcggacctgcggcacggctgggcgatcacggtgcaccgcgcgcagggctcg
gagtggcccggtgtcgtggtcgtgctaccgccggaggccggcgggatgctgtcccggccg
ctggtctacaccgccctgacccgggcgcagaagcacctgtcgatcgtgcacgccagcggc
gcggcgctggcccgcgcggtgcgcgaggtcgacgtccggccccggcgcacccggctgtcc
gggctgctcgccgagctcgccgactga

DBGET integrated database retrieval system