KEGG   Modestobacter marinus: MODMU_2863Help
Entry
MODMU_2863        CDS       T02167                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mmar  Modestobacter marinus
Pathway
mmar00630  Glyoxylate and dicarboxylate metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01120  Microbial metabolism in diverse environments
mmar01200  Carbon metabolism
Module
mmar_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MODMU_2863 (aceA)
Enzymes [BR:mmar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MODMU_2863 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CCH88292
UniProt: I4EY29
Position
2840601..2841908
Genome map
AA seq 435 aa AA seqDB search
MSQHPTRPGDAAETATDLAFAWQTDPRWAGIRRDHTAEDVVALRGPVVEEHTLARRGAER
LFELVQASDGQEWVSALGALTGNQAVQQVRAGLKAIYLSGWQVAADANTAGQTYPDQSLY
PVDSVPSVVRRINNALLRAGQVEATDGGASRDWLVPIVADAEAGFGGPLNAYELMRSMIA
AGAAGVHWEDQLASEKKCGHMGGKVLVPTGQHIRTLNAARLAADVAGVPSMVIARTDALA
ATLLTSDHDERDRPFLTGERTAEGFYTVRNGLDPVIARGLAYAPYADLIWVESATPDLEL
ARRFAEAVHAEFPDQRLAYNCSPSFNWRSHLDDDQIASFQRELAAMGYAFQFITLAGFHS
LNHSMFTLAQGYAERQMSAYVELQEAEFASEASGYTATRHQREVGTGYFDRIATALNPAS
STLALVGSTESEQFH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcaccccacccgccccggcgacgccgccgagaccgccaccgacctcgcgttc
gcctggcagaccgacccgcgctgggccggcatccgccgcgaccacaccgccgaggacgtc
gtggcactgcggggaccggtcgtggaggagcacacgctggcccgccggggcgccgagcgg
ctgttcgagctggtccaggccagcgacggccaggagtgggtgtccgcgctcggcgcgctc
accggcaaccaggccgtgcagcaggtccgggccgggctgaaggccatctacctgtccggc
tggcaggtcgccgccgacgcgaacaccgcggggcagacctaccccgaccagagcctctac
ccggtcgactcggtgccctccgtcgtccgccggatcaacaacgcgctcctgcgggccggc
caggtcgaggccaccgacggcggcgccagccgggactggctggtgccgatcgtcgccgac
gccgaggccggcttcggcgggccgctcaacgcctacgagctgatgcgctcgatgatcgcg
gccggggcggccggcgtgcactgggaggaccagctggcctcggagaagaagtgcggtcac
atgggcgggaaggtcctggtgcccaccggccagcacatccggacgctgaacgccgcccgg
ctggccgccgacgtggccggggtcccgtcgatggtcatcgcccggaccgacgccctcgcc
gcgacgctgctcaccagcgaccacgacgagcgcgaccgcccgttcctcaccggcgagcgg
acggcggagggcttctacaccgtccgcaacggcctggacccggtcatcgcccgcggcctg
gcctacgccccctacgccgacctgatctgggtcgagtccgccacccccgacctggagctc
gcccggcgcttcgccgaggcggtgcacgcggagttccccgaccagaggctggcctacaac
tgctcgccgtcgttcaactggcgcagccacctcgacgacgaccagatcgcctcattccag
cgggagctggccgccatgggctacgccttccagttcatcaccctggccggcttccactcc
ctcaaccactcgatgttcaccctggcccagggctacgccgagcggcagatgagcgcctac
gtggagctgcaggaggccgagttcgcctccgaggccagcggttacaccgccacccgccac
cagcgggaggtcggcaccggctacttcgaccggatcgccaccgcgctgaacccggccagc
tcgaccctcgccctggtcggctccaccgagtccgagcagttccactga

DBGET integrated database retrieval system