KEGG   Modestobacter marinus: MODMU_2864Help
Entry
MODMU_2864        CDS       T02167                                 

Gene name
aceB
Definition
(RefSeq) Malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mmar  Modestobacter marinus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MODMU_2864 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MODMU_2864 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MODMU_2864 (aceB)
Enzymes [BR:mmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MODMU_2864 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2841943..2843589
Genome map
AA seq 548 aa AA seqDB search
MTVLQTPAPHRSDRPASPPPPSGRIDVLGPAVPGAEEVLTPAALDFLAHLHDRFASGRAE
LLAARAVRRASLSNGQELRFSRQTPVVRYDPSWRVAGPGPGLADRRVELTGPADAATARA
ARHSGASTWVADLEDAMSPTWANVVGSQAVLADVVREWPTGAGPDAAPTLLVRPRGWHLV
EKHLCHTDATGRSTPASASLVDFGLFALANAARLVERGHGPYFYLPKLETAAEARLWDQV
FTETERVLGLRHGTIRATVLIETITAAFEMEEVLYELRHHCAGLNAGRWDYLFSIVKKFR
DRGPAWVLPDRSELTMTTPFMHACTDLLVSTCHRRGAHAIGAMSTAVPDDRDPAATREAL
AEVAADKRREAEQGFDGTWVAHPGLVEVARNAFDEVLGGATDQRHRQRADVRVTAAELLD
PRGLAGPVTDAGVRTNVSVAVRYMEAWLRGVGSVVLDGHVEDASTAEISRAQLWQWTTRR
TVTVEGTPVTRDLVERLLDEVVAEQPRTPGDRFDDAAAMVRSVTLEETFPTFFTVPGYVE
HLVTLPAR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcctgcagacccccgccccgcaccggtcggaccgaccggcgtcccctcccccg
ccgtccggccggatcgacgtgctcggccccgccgtcccgggcgccgaggaggtgctcacc
cccgccgcgctggacttcctcgcccacctgcacgaccggttcgcctccggccgcgccgag
ctgctcgccgcgcgcgccgtccgccgcgcgtcgctcagcaacggccaggagctccgcttc
agccggcagaccccggtggtgcgctacgacccctcctggcgggtcgccggccccggaccg
ggcctggccgaccggcgggtggagctcaccggcccggccgacgccgccaccgcgcgggcc
gcacggcactccggcgcctcgacctgggtcgccgacctggaggacgcgatgagccccacc
tgggccaacgtcgtcggcagccaggccgtgctggccgacgtcgtccgggagtggccgacc
ggcgccggaccggacgcggcgcccacgctgctggtccgcccccgcggctggcacctggtc
gagaagcacctgtgccacaccgacgccaccgggcggagcacgccggcatcggcctcgctg
gtcgacttcggcctgttcgccctcgccaacgccgcccggctggtcgagcgggggcacggg
ccgtacttctacctgccgaagctggagaccgcggccgaggcgcggctgtgggaccaggtc
ttcaccgagaccgagcgggtgctgggcctgcggcacggcacgatccgggcgaccgtgctc
atcgagacgatcaccgccgccttcgagatggaggaggtcctctacgagctgcggcaccac
tgcgccggcctcaacgccggccggtgggactacctgttcagcatcgtcaagaagttccgc
gaccgggggccggcctgggtgctgcccgaccggtcggagctgaccatgacgacgccgttc
atgcatgcctgcaccgacctgctggtgagcacctgccaccggcgcggggcccacgcgatc
ggcgcgatgagcacggcggtccccgacgaccgcgacccggccgccacccgggaggccctc
gccgaggtcgcggcggacaagcggcgggaggccgagcagggcttcgacggcacctgggtg
gcccatcccggcctggtcgaggtcgcgcggaacgccttcgacgaggtgctcggcggggcg
accgaccagcggcaccgacagcgcgcggacgtccgggtgaccgccgcggagctgctcgac
ccccgcgggctggccggtccggtgaccgacgccggggtccgcaccaacgtgtcggtcgcc
gtccgctacatggaggcctggctgcgcggggtgggctcggtcgtcctcgacggccacgtc
gaggacgcctccaccgcggagatcagccgcgcccagctgtggcagtggaccacccgccgg
acggtcaccgtcgagggcaccccggtgacccgcgacctggtcgagcggctgctggacgag
gtggtggccgagcagccccgcaccccgggcgaccggttcgacgacgccgcggcgatggtc
cggtcggtcaccctggaggagaccttcccgacgttcttcaccgtccccgggtacgtcgag
cacctggtgacgctgccggcccggtga

DBGET integrated database retrieval system