KEGG   Modestobacter marinus: MODMU_3163Help
Entry
MODMU_3163        CDS       T02167                                 

Definition
Arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mmar  Modestobacter marinus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MODMU_3163
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MODMU_3163
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MODMU_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3158793..3159527
Genome map
AA seq 244 aa AA seqDB search
MELLVVPYHLDERLDPFDLGVPADREVTAELPPGDPWSRMAALYEQVADAVGGGGVVVAS
GDCTTGLGVLAGLQRAGRDPAVVWFDAHADFHTAATTTSGYLGGMPLALAVGRGDLALPA
ALGLRPVAEDRVVLVDARDTDPGEHQLLSGSAVTRTTVAELTGVVPDGDLYVHVDVDVST
PAEVPDLLYPAAGGVRVDELLTAVRALVATGRVVALGLAATWHHTAAARPEHAALVRGLL
AAAP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctggtcgtcccctaccacctcgacgagcgcctcgaccccttcgacctgggc
gtccccgccgaccgcgaggtgaccgccgagctcccgcccggcgacccgtggagccggatg
gcagcgctgtacgagcaggtcgcggacgccgtcggcggcggcggggtcgtcgtcgcgtcc
ggggactgcaccaccggcctcggggtgctggccgggctgcagcgggccgggcgggacccg
gccgtcgtctggttcgacgcgcacgccgacttccacaccgccgccaccaccacctccggc
tacctcggcggcatgccgctggccctcgccgtcggccgcggcgacctggccctcccggcg
gcgctgggcctgcggccggtcgcggaggaccgcgtggtgctggtcgacgcgcgggacacc
gaccccggcgagcaccagctgctcagcggctcggcggtcacccgcaccacggtggccgag
ctgaccggcgtcgtcccggacggcgacctgtacgtgcacgtggacgtcgacgtcagcacc
cccgccgaggtcccggacctgctgtacccggcggccggcggggtgcgggtcgacgagctg
ctcaccgcggtccgggcgctggtcgccaccggccgggtcgtcgcgctcggcctggccgcg
acctggcaccacaccgccgcggcccgccccgagcacgccgcgctggtccgcgggctgctg
gccgccgcgccctga

DBGET integrated database retrieval system