KEGG   Modestobacter marinus: MODMU_3163Help
Entry
MODMU_3163        CDS       T02167                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mmar  Modestobacter marinus
Pathway
mmar00220  Arginine biosynthesis
mmar00330  Arginine and proline metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01130  Biosynthesis of antibiotics
mmar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MODMU_3163
   00330 Arginine and proline metabolism
    MODMU_3163
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MODMU_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CCH88587
UniProt: I4EYX4
Position
3158793..3159527
Genome map
AA seq 244 aa AA seqDB search
MELLVVPYHLDERLDPFDLGVPADREVTAELPPGDPWSRMAALYEQVADAVGGGGVVVAS
GDCTTGLGVLAGLQRAGRDPAVVWFDAHADFHTAATTTSGYLGGMPLALAVGRGDLALPA
ALGLRPVAEDRVVLVDARDTDPGEHQLLSGSAVTRTTVAELTGVVPDGDLYVHVDVDVST
PAEVPDLLYPAAGGVRVDELLTAVRALVATGRVVALGLAATWHHTAAARPEHAALVRGLL
AAAP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctggtcgtcccctaccacctcgacgagcgcctcgaccccttcgacctgggc
gtccccgccgaccgcgaggtgaccgccgagctcccgcccggcgacccgtggagccggatg
gcagcgctgtacgagcaggtcgcggacgccgtcggcggcggcggggtcgtcgtcgcgtcc
ggggactgcaccaccggcctcggggtgctggccgggctgcagcgggccgggcgggacccg
gccgtcgtctggttcgacgcgcacgccgacttccacaccgccgccaccaccacctccggc
tacctcggcggcatgccgctggccctcgccgtcggccgcggcgacctggccctcccggcg
gcgctgggcctgcggccggtcgcggaggaccgcgtggtgctggtcgacgcgcgggacacc
gaccccggcgagcaccagctgctcagcggctcggcggtcacccgcaccacggtggccgag
ctgaccggcgtcgtcccggacggcgacctgtacgtgcacgtggacgtcgacgtcagcacc
cccgccgaggtcccggacctgctgtacccggcggccggcggggtgcgggtcgacgagctg
ctcaccgcggtccgggcgctggtcgccaccggccgggtcgtcgcgctcggcctggccgcg
acctggcaccacaccgccgcggcccgccccgagcacgccgcgctggtccgcgggctgctg
gccgccgcgccctga

DBGET integrated database retrieval system