KEGG   Modestobacter marinus: MODMU_3230Help
Entry
MODMU_3230        CDS       T02167                                 

Definition
uroporphyrinogen III synthase HEM4 (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmar  Modestobacter marinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MODMU_3230
Enzymes [BR:mmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MODMU_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3220104..3221285
Genome map
AA seq 393 aa AA seqDB search
MTDPALDRPAGGPAGAAPAAGTAAPPAEELLPLRGYTVAVTAARRSEELGALLDRRGARV
VYAPAIRIVPLPDDADLVAATREVLAAPVDLVVATTGVGFRGWLEAAEAWDLPLREHLQS
ARVLARGPKARGAIRGAGLVDAWSPDSESSAEVLEHLLSGAEGPLPGRRIAVQLHGDPLP
ELVAGLVRAGAEVVRVPVYRWVLPEDTAPLRRLVVTIAGRGVDAVTFTSAPAAASLLQVA
AEEGVRAGVLTAFAEAVLPLAVGPVTAAPLEAAGIRTVQPERARLGALARSVVAELPARH
PVLAAGAHTLQVRGHAAVLDGRLVELPPGPMAVLRALARRPGVVVSRPDLLAELSGGGDA
HAVEMAVTRLRAALGAPVVETVVKRGYRLAVRA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccccgcgctcgaccgtcccgcgggcggcccggccggtgcagcgcccgctgcc
ggcaccgccgctcccccggccgaggagctgctgccgctgcgcggctacaccgtggccgtg
accgctgcccggcgcagcgaggaactgggcgcgctgctggaccggcgcggcgcccgggtg
gtctacgcgccggccatccggatcgtgccgctgcccgacgacgccgacctggtcgccgcc
acccgcgaggtcctcgccgcgccggtggacctggtggtggcgacgaccggggtcgggttc
cgcggctggctggaggcggccgaggcgtgggacctgccgctgcgcgagcacctgcagtcc
gcccgggtgctggcccgcggacccaaggcccgcggggcgatccgcggcgcgggtctcgtc
gacgcctggtccccggactcggagagctccgcggaggtgctcgagcacctgctgtccggt
gccgagggcccgctgcccggccggcggatcgccgtccagctgcacggcgacccgctgccc
gagctcgtcgccgggctggtccgggccggtgcggaggtggtgcgggtccccgtctaccgg
tgggtgctgccggaggacaccgccccgctgcgccgcctggtggtcacgatcgccggacgc
ggggtggacgcggtgaccttcaccagcgcgccggcggccgccagcctgctccaggtggcc
gccgaggagggcgtgcgcgccggcgtgctcaccgccttcgccgaggccgtccttccgctg
gcggtcggcccggtgaccgccgccccgctcgaggcggccggcatccgcacggtccagccg
gaacgggcccggctgggcgcgctggcccgctcggtcgtcgccgagctgcccgcccggcac
ccggtgctggccgccggcgcgcacaccctgcaggtccgcgggcacgccgccgtcctcgac
ggccggctggtggagctgccgcccggcccgatggcggtgctgcgggcgctggcccgccgg
cccggcgtcgtggtgtcccggcccgacctgctcgccgagctctccggcggcggcgacgcg
cacgcggtggagatggcggtgacccggctgcgggcggccctcggcgcgccggtcgtggag
accgtggtcaagcggggctaccggctcgcggtccgcgcctag

DBGET integrated database retrieval system