KEGG   Modestobacter marinus: MODMU_3276Help
Entry
MODMU_3276        CDS       T02167                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mmar  Modestobacter marinus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MODMU_3276
Enzymes [BR:mmar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MODMU_3276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3265643..3267532
Genome map
AA seq 629 aa AA seqDB search
MTSTAPQQPTTDAWGIDASWLDALDEEHTVAEATIARLRQVIGTPPEDLVDRAPIVARPG
DALEVDEADVECEDGQTRHVDGELPEDFPLGYHRLRTPDGRERRLIVSPGRCWLPEGWRG
WGWAVQLYATRGRGSWGIGDLGDLRAVRELAQEQGAGFVLVNPLHAVAPTPGQEASPYLP
ATRRFRNPLYLRIADVPGADAVDVEDDAGRALNDGELIDRDAVWALKRRVLQRVFDARPG
SGEDEQAFRDWWWHQGQPLMDWATWCALADQHGPDWHTWPRELQDPRGAAVRDFAAARER
EVAFHAWLQWQLDLQLRAATEGITVIQDLPIGVAGGGADAWAWQDVLAPGVSVGAPPDAF
NSQGQDWGSPPLVPWQLQAADYEPFVQSIRATMAGAGGLRVDHVMGLFRLWWVPSEGSAA
DGAYVRYPYEDLLDIVALESHRAQAIVVGEDLGTVEAGVREAMAEHGILSYKLLWFEDDE
PAHWPAEAMAAVTTHDLPTIPGLWTGSDLAEQRHHGLGTDEELERGRASLLEHLGKVPKK
ATPAKAVTAAYKRLAGAPCTLLSATLDDALAEERRPNMPGAADRPNWCLPLPVPTEELAT
HPGVQSVAQVLANGLQPGKKRTAKTKGRS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcaccgcgccgcagcagcccacgaccgacgcctggggcatcgacgccagctgg
ctcgacgccctcgacgaggagcacaccgtcgccgaggcgacgatcgcccggctgcggcag
gtcatcggcacgccgcctgaggacctcgtcgaccgcgccccgatcgtcgcccgccccggc
gacgccctcgaggtcgacgaggccgacgtcgagtgcgaggacgggcagacccggcacgtc
gacggcgagctgcccgaggacttcccgctgggctaccaccggctgcgcacccccgacggc
cgcgagcgccggctcatcgtctcccccggccggtgctggctgcccgagggctggcggggc
tggggctgggcggtgcagctgtacgccacccgcggccggggcagctggggcatcggcgac
ctgggcgacctgcgcgccgtccgcgagctcgcccaggagcagggcgccggcttcgtgctg
gtcaacccgctgcacgcggtggccccgacgcccggccaggaggccagcccctacctgccg
gccacccggcggttccgcaacccgctgtacctgcggatcgccgacgtgcccggcgccgac
gcggtcgacgtcgaggacgacgccgggcgggcgctcaacgacggcgagctgatcgaccgg
gacgccgtctgggcgctcaagcggcgggtgctgcagcgcgtcttcgacgcccggccgggc
agcggcgaggacgagcaggccttccgcgactggtggtggcaccagggccagccgctgatg
gactgggccacctggtgcgcgctggccgaccagcacggcccggactggcacacctggccc
cgggagctgcaggacccgcgcggtgccgccgtccgcgacttcgcggcggcccgggagcgg
gaggtggccttccacgcgtggctgcagtggcagctcgacctccagctgcgggcggccacc
gagggcatcaccgtcatccaggacctgccgatcggcgtcgccggcggcggggccgacgcc
tgggcctggcaggacgtgctcgccccgggggtgagcgtcggcgccccgccggacgccttc
aacagccagggccaggactggggctccccgccgctggtcccctggcagctgcaggcggcg
gactacgagccgttcgtccagtcgatccgggcgaccatggccggcgccggcgggctgcgg
gtggaccacgtgatgggactgttccggctctggtgggtgccctcggagggcagcgcggcc
gacggcgcctacgtccgctacccctacgaggacctgctcgacatcgtcgcgctggagagc
caccgggcgcaggcgatcgtcgtcggcgaggacctcggcaccgtcgaggccggcgtccgc
gaggcgatggccgagcacgggatcctgtcctacaagctgctctggttcgaggacgacgag
ccggcgcactggcccgccgaggcgatggccgcggtgaccacccacgacctgccgaccatc
ccggggctgtggaccgggtccgacctcgccgagcagcgccaccacgggctgggcaccgac
gaggagctcgagcgcgggcgcgcctcgctgctcgagcacctggggaaggtgccgaagaag
gcgacgccggccaaggccgtgacggcggcctacaagcggctggccggcgccccgtgcacg
ctgctgtcggccaccctggacgacgcgctcgccgaggagcgccggccgaacatgcccggc
gcggccgaccggcccaactggtgcctcccgctgccggtgccgaccgaggagctggccacc
caccccggcgtgcagtccgtcgcgcaggtgctggcgaacggactgcagccggggaagaag
cggaccgccaagaccaaggggaggtcctga

DBGET integrated database retrieval system