KEGG   Modestobacter marinus: MODMU_3324Help
Entry
MODMU_3324        CDS       T02167                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase (catalytic subunit)
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmar  Modestobacter marinus
Pathway
mmar00240  Pyrimidine metabolism
mmar00250  Alanine, aspartate and glutamate metabolism
mmar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MODMU_3324 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MODMU_3324 (pyrB)
Enzymes [BR:mmar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MODMU_3324 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CCH88737
UniProt: I4EZC4
Position
complement(3308305..3309231)
Genome map
AA seq 308 aa AA seqDB search
MKRHLLEAADLDRDDATLVLDTAAQIESALAGREVKKLPTLRGRTVVNLFYEDSTRTRIS
FELAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGSDAIVVRHSASGAPHRLAQWV
AGSVVNAGDGTHEHPTQALLDAYTIRQRLGRLDGVRVVIVGDVLHSRVARSNVWLLATLG
AEVTLVAPPTLLPVGVGSWPVQVSYDLDAVLPKADVVMMLRVQGERMNASFFPSAREYSR
RYGLDGRRMAALADDAIVMHPGPMNRGMEIAAEVADSARSTIVDQVGNGVSVRMAVLYLL
LGGASASE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcacctgctggaggccgccgacctggaccgggacgacgccacgctggtgctc
gacacggcggcgcagatcgagtcggcgctggccggccgcgaggtcaagaagctgcccacg
ctgcgcggccgcaccgtggtcaacctcttctacgaggactccacccgcacccggatctcc
ttcgagctggccgccaagcggttgagcgccgacgtcatcaacttctccgccaagggcagc
agcgtctccaagggcgagagcctcaaggacaccgcgctgaccctggaggcgatgggcagc
gacgcgatcgtcgtccggcacagcgcctccggcgccccgcaccggctggcgcagtgggtg
gccggcagtgtggtcaacgctggcgacggcacccacgagcacccgacgcaggccctgctg
gacgcctacacgatccggcagcgactgggccggctcgacggcgtccgggtggtcatcgtg
ggcgacgtgctgcacagccgggtcgcccgctccaacgtctggctgctcgccacgctcggc
gccgaggtcaccctggtcgccccgcccaccctgctgccggtcggcgtcgggagctggccg
gtgcaggtgagctacgacctggacgccgtcctgcccaaggccgacgtggtgatgatgctg
cgggtgcagggggagcggatgaacgcctcgttcttccccagcgcccgggagtacagccgc
cggtacggcctggacggccggcggatggccgcgctggccgacgacgccatcgtcatgcac
cccggcccgatgaaccgcggcatggagatcgccgccgaggtcgccgactccgcccgctcc
acgatcgtcgaccaggtcggcaacggcgtctcggtccggatggcggtcctctacctgctc
ctgggaggggcatccgcaagtgagtga

DBGET integrated database retrieval system