KEGG   Modestobacter marinus: MODMU_3358Help
Entry
MODMU_3358        CDS       T02167                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmar  Modestobacter marinus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmar03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3341554..3342192)
Genome map
AA seq 212 aa AA seqDB search
MIASVSGRVAAVSPDGAVVEVGGVGLSVQCTPGTIARLTVGEQARLATSLVVREDSLTLY
GFADDDERQLFELLQTANGVGPRLAQAVLAIHPPREVRRAVSMGDLKALMQVPGIGKKGA
ERLVLELRDRLGSTTSDTSLDGPAPAGLGSVTPVAPWRDQLTAALVSLGWTGKEAEGAVG
QLAPVADEQVAATGAVEIAVLLRQALRLLGRA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcctcggtctccggccgggtcgcggccgtgtcccccgacggcgccgtcgtcgag
gtcggcggggtgggcctgtcggtgcagtgcacccccggcaccatcgcccggctcacggtg
ggggagcaggcccggctggccaccagcctcgtcgtccgcgaggactcgctcaccctctac
ggcttcgccgacgacgacgagcgccagctgttcgagctgctgcagaccgccaacggcgtc
gggccgcggctggcgcaggcggtgctggccatccacccgccccgcgaggtgcgccgcgcg
gtgtcgatgggcgacctgaaggcgctcatgcaggtgccggggatcggcaagaagggcgcc
gagcggctggtcctggagctgcgcgaccggctcggcagcacgaccagcgacacctcgctg
gacgggcccgccccggccggcctcgggtcggtcaccccggtcgcgccctggcgtgaccag
ctgaccgccgccctggtcagcctgggctggaccggcaaggaggccgagggcgcggtcggc
cagctggcgccggtcgccgacgagcaggtggccgccaccggggccgtcgagatcgccgtg
ctgctgcggcaggcgctgcggctgctgggccgggcatga

DBGET integrated database retrieval system