KEGG   Modestobacter marinus: MODMU_3405Help
Entry
MODMU_3405        CDS       T02167                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmar  Modestobacter marinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MODMU_3405 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MODMU_3405 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MODMU_3405 (trpA)
Enzymes [BR:mmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MODMU_3405 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3389837..3390715)
Genome map
AA seq 292 aa AA seqDB search
MSAPEDDGGVSIAASASERGAERSRSRGSLLADAIGAAKAEGRAALIAYLPVGYPDVDTS
IAAMVAAVEGGADVVEVGVPYSDPGMDGPVIQEAVDVAVRAGVGMRDVLRAVTAVAEAGA
VPVVMSYWNPIERYGVDRFADDLAAAGGAGAITPDLIPDEASAWLAATERTGLDRVFLVA
PSSTDTRLAATAEASRGFVYAASTMGVTGTRATVGDAAERLVARTRSVTGTAVCVGLGVS
SGDQAAEVAAFADGVIVGSAYVRALLAGEGADGVRVLSQELAAGVRRAKVRA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcccgaggacgacggcggagtgagcatcgcagcgagcgccagcgagcgagga
gcggagcggagccggagtcgaggcagtctgctggctgatgcgatcggggcggccaaggcc
gaggggcgggcggcgctgatcgcctacctgccggtcggctaccccgacgtcgacacctcc
atcgccgccatggtggccgccgtcgagggcggggcggacgtcgtcgaggtcggcgtcccg
tactccgaccccggcatggacggcccggtgatccaggaggcggtggacgtcgccgtccgg
gccggggtgggcatgcgcgacgtgctgcgggccgtgaccgcggtggccgaggccggcgcg
gtgccggtggtgatgagctactggaacccgatcgagcgctacggcgtcgaccggttcgcc
gacgacctggccgccgccgggggagcgggggcgatcacccccgacctcatccccgacgag
gcctcggcctggctggccgcgaccgagcgcaccggcctggaccgggtgttcctggtcgcg
ccgagctcgaccgacacccggctggccgccaccgccgaggcctcgcgcggcttcgtctac
gccgcctccaccatgggggtcaccggcacccgggccaccgtcggcgacgccgccgagcgg
ctggtcgcccgcacccgctcggtcaccggcaccgcggtctgcgtgggcctcggcgtctcc
agcggggaccaggccgcggaggtcgcggccttcgccgacggcgtcatcgtcggctccgcc
tacgtccgggccctgctggccggcgagggcgccgacggcgtgcgtgtcctgtcgcaggag
ctcgccgcgggcgtccggcgtgcgaaggtgcgcgcatga

DBGET integrated database retrieval system