KEGG   Modestobacter marinus: MODMU_3406Help
Entry
MODMU_3406        CDS       T02167                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmar  Modestobacter marinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MODMU_3406 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MODMU_3406 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MODMU_3406 (trpB)
Enzymes [BR:mmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MODMU_3406 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3390712..3392106)
Genome map
AA seq 464 aa AA seqDB search
MTLSAHAPAPDVPDATARPEWPDATGHFGVYGGRFVPEALVAALDELTEAYEAMRVDPAF
IAEFARLQRDYTGRPSPVTEVARFAEHCGGARVLLKREDLNHTGSHKINNVLGQALLTKR
IGKTRVIAETGAGQHGVATATAAALMGLSCTVYMGEEDTRRQALNVARMRLLGAEVIPVT
TGSRTLKDAINEAFRDWVTNVETTNYVFGTVAGPHPFPAMVRDFQRVIGDEAREQVLERE
GRLPDVVLACVGGGSNAIGIFTAFVPDDGVRLVGLEAGGDGVDTGRHAATITGGDPGVLH
GARSYLLQDDNGQTIESHSISAGLDYPGVGPEHAFLHDIGRAEYRPVTDAEAMEAFALLC
RTEGIIPAIESAHALAGAMVVGRELGPDALLLVNLSGRGDKDVETASAWFGLGEHTAPTD
EDERAVEAGRGAEPGPGLDDDQQPTEGAVSNDEAVAGQDAGEQA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccctctccgcgcacgccccggcccctgacgtccccgacgccacggcgcgcccggag
tggccggacgcgaccgggcacttcggcgtctacggcggccggttcgtccccgaggcgctg
gtcgccgccctcgacgagctcaccgaggcctacgaggccatgcgggtcgaccccgccttc
atcgccgagttcgcccggctgcagcgcgactacaccggccggcccagcccggtcaccgag
gtcgcccggttcgccgagcactgcggcggcgcccgggtgctgctcaagcgcgaggacctc
aaccacaccggctcgcacaagatcaacaacgtgctgggccaggcgctgctcaccaagcgc
atcggcaagacccgggtgatcgccgagaccggtgccgggcagcacggggtggcaaccgcg
accgccgccgcgctgatggggctgtcctgcaccgtgtacatgggcgaggaggacacccgg
cggcaggcgctcaacgtcgcccggatgcggctgctgggcgccgaggtcatcccggtcacc
accgggtcgcgcaccctcaaggacgcgatcaacgaggcgttccgcgactgggtgaccaac
gtggagaccacgaactacgtcttcggcaccgtcgccggcccgcacccgttcccggcgatg
gtccgcgacttccagcgggtgatcggcgacgaggcccgcgagcaggtcctcgagcgggag
ggccggctgcccgacgtcgtcctggcctgcgtcggcggcgggtcgaacgcgatcggcatc
ttcaccgcgttcgtgcccgacgacggcgtccggctggtcggcctggaggccggcggggac
ggcgtggacaccggccggcacgccgccacgatcaccggcggcgaccccggggtgctgcac
ggcgcccgctcctacctgctgcaggacgacaacgggcagacgatcgagtcgcactcgatc
tcggcgggcctggactacccgggggtcggccccgagcacgccttcctgcacgacatcgga
cgcgcggagtaccgcccggtcaccgacgccgaggcgatggaggcgttcgcgctgctctgc
cgcaccgagggcatcatcccggcgatcgagtccgcgcacgccctcgccggcgcgatggtg
gtcggccgggagctgggtccggacgcgctgctgctggtcaacctctccggccgcggggac
aaggacgtcgagacggcgagcgcctggttcggcctcggggagcacaccgccccgaccgac
gaggacgagcgggccgtcgaggccggccggggcgccgagcccggccccgggctggacgac
gaccagcagcccaccgagggcgcggtcagcaacgacgaggccgtcgccggtcaggatgcg
ggggagcaggcgtga

DBGET integrated database retrieval system