KEGG   Modestobacter marinus: MODMU_3509Help
Entry
MODMU_3509        CDS       T02167                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmar  Modestobacter marinus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MODMU_3509 (pfkA)
   01230 Biosynthesis of amino acids
    MODMU_3509 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MODMU_3509 (pfkA)
   00030 Pentose phosphate pathway
    MODMU_3509 (pfkA)
   00051 Fructose and mannose metabolism
    MODMU_3509 (pfkA)
   00052 Galactose metabolism
    MODMU_3509 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MODMU_3509 (pfkA)
Enzymes [BR:mmar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MODMU_3509 (pfkA)
Protein phosphatases and associated proteins [BR:mmar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MODMU_3509 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3501134..3502159)
Genome map
AA seq 341 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAVVRAGITEYGDEVVGFRDGWRGVLDGDVVALDVAATRGL
LPRGGTVLGTSRTNPYAVEGGPERLLATLERLDIDALVPVGGEDTLGVANRLAAAGVRCV
GVPKTIDNDLDATDYTFGFDTAVGVASEAIDRLHTTGDSHHRALVVEVMGRHAGWIALHA
GMSGGATVVLVPERPFDVDAVVKHCQHRFDSGFSPIVVVSEGAVPADGHLTTTSGQRDAF
GHERLGGIGEALARVIEERTGRESRAVVLGHVQRGGTPTPFDRVLATRFGLAAVRAVHEG
ASGVMVALRGTDIVQVPLAEAIAQLKLVPLERYAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcggcatcctgaccggcggcggcgactgccccggcctgaacgcggtgatccgc
gccgtcgtccgggccggcatcaccgagtacggcgacgaggtggtcggcttccgggacggc
tggcgcggcgtcctcgacggggacgtcgtggcgctggacgtcgccgcgacccgggggctg
ctgccgcgcggcggcacggtgctcggcacctcgcggaccaacccctacgcggtcgagggc
ggcccggagcggctgctggcgaccctggagcggctggacatcgacgcgctcgtcccggtg
ggcggggaggacaccctgggcgtggccaaccggctcgccgccgcgggggtccgctgcgtc
ggggtgcccaagaccatcgacaacgacctggacgccaccgactacacgttcggcttcgac
accgccgtcggcgtcgcatcggaggcgatcgaccggctgcacaccaccggcgacagccac
caccgggcgctggtcgtggaggtcatgggccggcacgccgggtggatcgcgctgcacgcc
ggcatgtccggtggggcgacggtcgtgctcgtccccgagcggcctttcgacgtcgacgcc
gtcgtcaagcactgccagcaccggttcgactccggcttcagcccgatcgtcgtcgtctcc
gagggcgccgtccccgccgacgggcacctcaccacgacgagcgggcagcgggacgccttc
ggccacgagcggctgggcggcatcggggaggcgctggcgcgggtgatcgaggagcgcacc
ggccgggagtcgcgggcggtggtgctcgggcacgtccagcggggcgggacgcccacgccc
ttcgaccgggtgctggccacccggttcgggctggccgcggtccgggccgtgcacgagggc
gcgtcgggggtgatggtggcgctgcgcggtaccgacatcgtccaggtgccgctggccgag
gccatcgcccagctcaagctggtgccgctggagcgctacgccgaggcggaggtcttcttc
ggctga

DBGET integrated database retrieval system