KEGG   Modestobacter marinus: MODMU_3516Help
Entry
MODMU_3516        CDS       T02167                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mmar  Modestobacter marinus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MODMU_3516 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MODMU_3516 (glcK)
   00052 Galactose metabolism
    MODMU_3516 (glcK)
   00500 Starch and sucrose metabolism
    MODMU_3516 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MODMU_3516 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MODMU_3516 (glcK)
   00524 Butirosin and neomycin biosynthesis
    MODMU_3516 (glcK)
Enzymes [BR:mmar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MODMU_3516 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3508525..3509526)
Genome map
AA seq 333 aa AA seqDB search
MTATPPAPDVAQLPAIGIDIGGTKVAGGVVAPDGTITDTARRATPGKSVSATEDAIAAVV
DELAERHDGPLVGVGVGAAGWFDRTGDTVLFSPHLAWRNQSLRKDLADRLQRPLWVGNDA
DAAAWAEYRYGAARGSSLMLMITLGTGIGGGIVIDGRLQRGAHGVAGEWGHMRVVPDGRL
CACGNRGCWEQYASGNALGHTAREVAQSSPAAAADLLDRVGGDAARITGEVVAQAAADGD
PLAVELLCEVGTWLGQGIADMAAILDPDVVVIGGGVSVLGETILAPARDRLERALPGRGF
RPGPRVVVAELGAQAGLVGAADLARQAVCDGVG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaccccgcccgccccggacgtcgcccagctgcccgccatcggcatcgacatc
ggcggcaccaaggtcgccggcggcgtcgtcgccccggacggcaccatcaccgacaccgcc
cgccgggccacccccgggaagtcggtcagcgccaccgaggacgccatcgccgcggtcgtc
gacgagctggccgagcggcacgacgggccgctggtcggcgtcggcgtcggcgcggccggc
tggttcgaccgcaccggcgacaccgtgctgttcagcccgcacctggcctggcggaaccag
tcgctgcgcaaggacctcgccgaccggctgcagcgcccgctctgggtgggcaacgacgcc
gacgccgccgcctgggcggagtaccgctacggcgccgcccggggcagcagcctgatgctg
atgatcacgctgggcaccgggatcggtggcggcatcgtcatcgacggccggctgcagcgc
ggtgcgcacggcgtcgcgggcgagtggggccacatgcgcgtggtccccgacggccggctc
tgcgcctgcgggaaccgcggctgctgggagcagtacgccagcggcaacgccctcgggcac
accgcccgcgaggtcgcccagagctcgccggcggccgcggccgacctgctggaccgggtg
ggcggggacgccgcccggatcaccggcgaggtggtcgcccaggcggcggccgacggcgac
ccgctggccgtcgagctgctctgcgaggtcggcacctggctgggtcagggcatcgcggac
atggcggcgatcctggaccccgacgtcgtggtcatcggtggcggcgtgagcgtgctgggc
gagacgatcctggcgccggcgcgcgaccggctcgagcgggcgctgcccggccgcgggttc
cgccccggcccgcgggtggtcgtcgccgagctgggcgcccaggccgggctggtcggcgcg
gccgacctcgcccgccaggccgtctgcgacggcgtgggctag

DBGET integrated database retrieval system