KEGG   Modestobacter marinus: MODMU_3538Help
Entry
MODMU_3538        CDS       T02167                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mmar  Modestobacter marinus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mmar00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3529467..3531401
Genome map
AA seq 644 aa AA seqDB search
MCGLLAYLSTDAERVDEQTVAGVQHALRCLRHRGPDDREVWSDPHAVLGFNRLAFIDIEG
SPQPMPYAGDRYRIVFNGEIYNYLELREELKAAGATFATEGDTEAIVAGYHLWGEAVVPR
LRGMFAFVIWDSQTGTAFGARDAFGIKPLFTARLADGGLVFSSEKKALLELLGGSDAAGG
VDAASLQHYLTLQYVPEPATLHRGIRRIESGTSFTVVDGELHTARWFHPRFDSRPVAPGQ
EQALYDRIAEVLDDSVAKHMRADVTVGSFLSSGIDSTAIAALAHKYNRDLVTFTVGFQRE
ATSEVEIAAESAAILGVRHVPVEVTAEEFAEAIPTVVWYLDDPVADPALVPLYFVAREAR
KHVKVVLSGEGADELFGGYTIYREPLSLAWASKLPAVGRQALGRLSRLVPEGVRGQDLLR
RASIPLEERYYGNARNLNADELAQLLPGRDPDLSHVTVTEALYRQTREAGYDDVTAMQYV
DLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFALASSLPLEMRVPRRGDATKFALRQ
AMRQIVPPKIMNRRKLGFPVPTAEFLAGPLHDWAQTIVKDSQTDEWLDRDHVLGLLERLA
QAEVPSKRIARQVWEVLVFMIWHGIFVEERIHPEVPEPVYPVRL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtctgctggcctacctgtccaccgacgccgaacgggtcgacgagcagacggtc
gcgggggtgcagcacgcgctgcgctgcctgcgccaccgcggcccggacgaccgggaggtg
tggtccgacccgcacgccgtcctcgggttcaaccggctggcgttcatcgacatcgagggc
agcccgcagccgatgccctacgccggtgaccgctaccggatcgtcttcaacggcgagatc
tacaactacctggagctccgcgaggagctcaaggccgctggcgcgaccttcgcgaccgag
ggcgacaccgaggcgatcgtcgccgggtaccacctgtggggcgaggcggtggtcccgcgg
ctgcgcggcatgttcgccttcgtgatctgggacagccagaccgggacggcgttcggcgcc
cgggacgccttcggcatcaagccgctgttcaccgcgcggctggccgacggcgggctggtc
ttcagctcggagaagaaggcgctgctggagctgctgggcggcagcgacgcggccggcggg
gtcgacgcggcctcgctgcagcactacctgaccctgcagtacgtgccggagccggcgacc
ctgcaccggggcatccggcggatcgagagcggcaccagcttcaccgtcgtcgacggcgag
ctgcacaccgcccgctggttccacccccggttcgacagccggccggtggccccggggcag
gagcaggcgctctacgaccggatcgccgaggtcctcgacgactcggtcgccaagcacatg
cgcgcggacgtgaccgtcgggtcgttcctgtccagcggcatcgactcgacggcgatcgcg
gcgctggcgcacaagtacaaccgggacctggtgaccttcaccgtcgggttccagcgcgag
gccacctccgaggtcgagatcgccgcggagtccgccgccatcctgggcgtccggcacgtg
ccggtcgaggtgaccgccgaggagttcgccgaagcgatcccgacggtggtctggtacctg
gacgacccggtcgccgacccggcgctggtgccgctgtacttcgtggcccgcgaggcgcgc
aagcacgtcaaggtcgtgctctccggcgagggggccgatgagctcttcggcggctacacg
atctaccgcgagccgctgagcctggcgtgggcgtcgaagctgcccgcggtgggcaggcag
gcgctgggccggctgtcccggctggttcccgagggcgtccgcggccaggacctgctgcgc
cgcgcgtcgatcccgctggaggagcggtactacggcaacgcccgcaacctcaacgccgac
gagctcgcccagctgctgcccggccgcgacccggacctgtcgcacgtgacggtcaccgag
gcgctgtaccggcagacccgggaggccggctacgacgacgtgacggcgatgcagtacgtc
gacctgttcacctggttgcgcggcgacatcctggtcaaggccgacaagatgacgatggcc
aactcgctggagctgcgggtgccgttcctcgaccccgaggtgttcgccctcgccagcagc
ctgccgctggagatgcgggtcccccgccgcggcgacgcgaccaagttcgcgctccggcag
gccatgcgccagatcgtgccgccgaagatcatgaaccgccgcaagctcggcttcccggtg
ccgacggcggagttcctggccggcccgttgcacgactgggcgcagacgatcgtcaaggac
agccagaccgacgagtggctcgaccgcgaccacgtgctcggcctgctggagcggctggcc
caggccgaggtgcccagcaagcggatcgcccggcaggtatgggaggtgctcgtcttcatg
atctggcacggcatcttcgtcgaggagcggatccaccccgaggtcccggagccggtctac
ccggtccggctgtga

DBGET integrated database retrieval system