KEGG   Modestobacter marinus: MODMU_3550Help
Entry
MODMU_3550        CDS       T02167                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmar  Modestobacter marinus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MODMU_3550 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MODMU_3550 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MODMU_3550 (sucB)
Enzymes [BR:mmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MODMU_3550 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3540918..3542789
Genome map
AA seq 623 aa AA seqDB search
MPTSVTMPALGESVTEGTVTRWLKQEGDQVEVDEPLLEVSTDKVDTEIPSPAAGVLSKIV
VAEDETVEVGAELAVIGGDAGGDGGAPAQEAPAQEEPAQEAPAQEEPTQHAPAQEEPAQE
TPAQEEPAPAAPSGGSPGGGEGTKVTMPALGESVTEGTVTRWLKAVGDEVAADEPLLEVS
TDKVDTEIPSPVSGTLLSITVNEDETVDVGAELAVIGAAGAAPASAPAPSTPAPPADEPQ
QSAPETEAPAPVAQEAQPTPVKATTDTGQPGADYGSSGAMPTQSPTDQPSPAEAVAPASP
PATAPAGAAAYVTPLVRRLAADNGVDLATVEGTGVGGRIRKQDVLAAAEKAAQPAPAAAA
APAAAATSGQPTPSPAATPDSSLRGRTEKMSRLRTVIAKRMVESLEISAQLTTVVEADVT
RIANLRNQVKNDFAAREGVKLSFLPFFAKAAVEALKAHPAVNSSVDMAAGTVTYHDSENL
GIAVDTERGLLVPVIRGAGDLSLAGIARKIGDLAERTRANKVTPDELGGGTFTLTNTGSR
GALFDTPIINQPQVAILGVGSVVKRPVVVQDPELGEVIAVRSMVYLALTYDHRIVDGADA
ARFLTTVRERLEAGQFHGELGLS
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgtccgtcaccatgcccgccctgggcgagagcgtcaccgagggcacggtcacc
cgctggctgaagcaggagggtgaccaggtcgaggtcgacgagccactcctcgaggtgtcc
acggacaaggtggacaccgagatcccgtccccggccgccggcgtcctgtcgaagatcgtc
gtcgccgaggacgagaccgtggaggtcggtgcggagctggccgtgatcggcggcgacgcc
ggtggcgacggtggcgccccggctcaggaggcccctgcccaggaggagcccgcgcaggag
gcacccgcccaggaggagccgactcagcacgcacctgcccaggaggagccggcgcaggag
acacctgcccaggaggagcccgcaccggccgcgccgtccggcggctcgccgggtggcggt
gagggcaccaaggtcaccatgccggcgctgggcgagagcgtcaccgagggcacggtcacc
cgctggctgaaggccgtcggtgacgaggtcgcggccgacgagccgctgctcgaggtctcg
acggacaaggtcgacaccgagatcccctccccggtgtcgggcacgctgctgtcgatcacc
gtcaacgaggacgagaccgtcgacgtcggtgcggagctcgcggtcatcggtgccgccggg
gccgcgcccgcctcggcccccgcaccgtccacccctgcgccgccggccgacgagccgcag
cagtcggccccggagaccgaggcgcccgcgcccgtcgcgcaggaggcccagccgaccccg
gtgaaggccaccaccgacaccggccagcccggtgcggactacggctccagcggtgccatg
ccgacccagtcccccaccgaccagccctcgccggccgaggccgtggcgccggcgagcccg
ccggcgaccgcgcccgcaggcgctgccgcttacgtgaccccgctcgtgcgccggctcgcc
gccgacaacggggtggacctggcgacggtcgagggcaccggggtgggcggacgcatccgc
aagcaggacgtgctggccgccgccgagaaggccgcccagcccgcccccgctgcggccgcc
gccccggctgctgccgcgacgtcgggtcagcccacgccgtcgccggccgccacgccggac
agctcgctgcgcggccgcaccgagaagatgtcgcggctgcgcacggtcatcgcgaagcgg
atggtcgagtccctggagatcagcgcccagctgacgaccgtggtcgaggccgacgtcacc
cggatcgccaacctgcgcaaccaggtgaagaacgacttcgccgcccgcgagggcgtcaag
ctctcgttcctgccgttcttcgccaaggcggccgtcgaggcgctcaaggcccaccccgcg
gtgaactcctcggtggacatggccgcgggcacggtcacctaccacgacagcgagaacctg
ggcatcgccgtcgacaccgagcgcggtctgctcgtcccggtgatcaggggtgccggggac
ctcagcctggccggcatcgcccggaagatcggcgacctcgcggagcggacccgcgccaac
aaggtcacccccgacgagctgggcggcgggacgttcacgctgaccaacaccggcagccgg
ggcgcgctgttcgacaccccgatcatcaaccagccgcaggtcgcgatcctgggcgtcggc
tcggtcgtgaagcggccggtcgtcgtgcaggacccggagctgggtgaggtcatcgccgtc
cggtcgatggtctacctggcgctgacctacgaccaccggatcgtcgacggcgccgacgcc
gcccgcttcctcaccacggtgcgggagcggctggaggccggtcagttccacggagagctc
ggcctgtcctga

DBGET integrated database retrieval system