KEGG   Modestobacter marinus: MODMU_3627Help
Entry
MODMU_3627        CDS       T02167                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmar  Modestobacter marinus
Pathway
mmar00010  Glycolysis / Gluconeogenesis
mmar00051  Fructose and mannose metabolism
mmar00562  Inositol phosphate metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01120  Microbial metabolism in diverse environments
mmar01130  Biosynthesis of antibiotics
mmar01200  Carbon metabolism
mmar01230  Biosynthesis of amino acids
Module
mmar_M00002  Glycolysis, core module involving three-carbon compounds
mmar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MODMU_3627 (tpiA)
   00051 Fructose and mannose metabolism
    MODMU_3627 (tpiA)
   00562 Inositol phosphate metabolism
    MODMU_3627 (tpiA)
Enzymes [BR:mmar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MODMU_3627 (tpiA)
Exosome [BR:mmar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MODMU_3627 (tpiA)
  Exosomal proteins of bladder cancer cells
   MODMU_3627 (tpiA)
  Exosomal proteins of melanoma cells
   MODMU_3627 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCH89037
UniProt: I4F074
Position
complement(3620583..3621392)
Genome map
AA seq 269 aa AA seqDB search
MARTRPKPPREGRRPLIAGNWKMHLTHLEAIGLVQKLAFSLTEAQLDAAEVVVVPPFTAL
RSVQTLVAGDKLEIGYGAQDLSAHDSGAYTGEVSGAMLAALACRYVLVGHSERRTLHGED
DAVVAAKVQAALRHGLVPLLCVGEGLDVRRAGSHVAHCTDQLDLALAGLTAEQVADLVVA
YEPVWAIGTGEVATPDDAQEVCGALRARLAERYGPETGAAIRILYGGSVKAGNTAGILAG
PDVDGALVGGASLDADEFAQICRTAAGGS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaccaggcccaagccgccccgcgagggacgccgcccgctcatcgccggcaac
tggaagatgcacctcacgcacctggaggccatcggcctggtgcagaagctggcgttctcg
ctgaccgaggcccagctggacgcggccgaggtggtcgtcgtcccgccgttcacggcgctg
cgcagcgtgcagacgctggtcgccggcgacaagctggagatcggctacggcgcccaggac
ctctccgcccacgactccggcgcctacaccggcgaggtgagcggggcgatgctcgccgcg
ctggcctgccggtacgtgctggtcggccattccgagcggcgcacgctgcacggcgaggac
gacgcggtggtcgcggccaaggtgcaggccgcgctgcggcacggcctggtgccgctgctg
tgcgtgggggaggggctcgacgtccgccgggccggcagccacgtggcgcactgcaccgac
cagctcgacctcgcgctggccgggctgaccgccgagcaggtggccgacctcgtggtggcc
tacgagccggtgtgggcgatcggcaccggcgaggtggccacccccgacgatgcgcaggag
gtctgcggggcactccgggcgcggctcgccgagcgctacggcccggagacgggggcggcg
atccgtatcctctacggcgggtcggtgaaggccggcaacaccgccggcatcctcgccggg
ccggacgtcgacggagcgctcgtcggcggtgccagcctggacgccgacgagttcgcacag
atctgtcgtaccgctgccggtgggagctga

DBGET integrated database retrieval system