KEGG   Modestobacter marinus: MODMU_3932Help
Entry
MODMU_3932        CDS       T02167                                 

Gene name
ppgK
Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mmar  Modestobacter marinus
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:mmar01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmar00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mmar00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3897385..3898128
Genome map
AA seq 247 aa AA seqDB search
MQGFGVDIGGSGIKGCVVDLDKGELVGERVRIPTPQPALPDPVYGVVADIVGQFGWEGRI
GVTYPGVMKHGVTFTAANMDSSWIGTDMAKGLEAVIPGTVQTLNDADAAGIAEMAYGAGK
GERGLVLMLTFGTGIGSALFIDGTLVPNTEFGHIEVGGHDGEKHASASAREREGLSYPQW
AKHVDRYLDTLERSIWPDLIIVGGGVSKKADKWVPLLSTRTRVVPAELLNDAGIVGAALA
AEQHIGQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgcagggcttcggagtggacatcggtggcagcggcatcaagggttgcgtggtcgacctg
gacaagggcgagctggtcggtgagcgggtgcgcatcccgacgccgcaaccggcgctgccc
gaccccgtgtacggggtggtggcggacatcgtcgggcagttcggctgggaggggcgcatc
ggcgtcacctacccgggggtgatgaagcacggcgtgacgttcaccgccgccaacatggac
tcctcctggatcggcaccgacatggccaaggggctggaggcggtgatcccgggcacggtg
cagacgctgaacgacgccgacgcggccgggatcgccgagatggcctacggcgccggcaag
ggcgagcgcggcctggtgctcatgctcaccttcggcaccggcatcggcagcgccctgttc
atcgacggcacgctcgtgcccaacaccgagttcgggcacatcgaggtcggcggtcacgac
ggcgagaagcacgcctcggcgtccgcccgcgagcgcgaggggctcagctacccgcagtgg
gccaagcacgtcgaccgctacctggacaccctcgagcgcagcatctggcccgacctgatc
atcgtcgggggcggggtcagcaagaaggccgacaagtgggtgccgctgctgtccacccgc
acccgggtggtccccgccgagctgctcaacgacgccggcatcgtcggggccgcactcgcc
gcggagcagcacatcggccagtga

DBGET integrated database retrieval system