KEGG   Modestobacter marinus: MODMU_3995Help
Entry
MODMU_3995        CDS       T02167                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Organism
mmar  Modestobacter marinus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3965060..3965995)
Genome map
AA seq 311 aa AA seqDB search
MRLSPWPTPLDPAPRLAAALGLQPDDLWVKRDDLTSFAGGNKVRKLEHLVGEAEAGGATV
LVTSGGVQSNHARMTAAAAAVRGLRAVLVLFGEADAARAGNLALEELFGARVVVVGPGED
VDARVAAVAEELRGDGEVPAVLPLGGSTPTGARGYLACAAELAEQLPGLDTVVVAVGSGG
TMAGLVAGLGAERVLGVDTGAVDDPDVRVTALATALGATVGDLRLRRDQVGAGYGQLTDA
AAAAMTTAARTQGLVLDPVYTGKALAGLAAAVADGSVRPGRRTVFLHTGGLPGLFGHPYA
AQLAGELLGRA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcctgtccccgtggccgaccccgctggaccccgcgccccggctggcggcggccctg
ggcctgcagccggacgacctgtgggtcaagcgggacgacctcacctccttcgccggcggc
aacaaggtccgcaagctcgagcacctggtcggcgaggccgaggccggcggcgccaccgtg
ctggtcaccagcggcggggtgcagagcaaccacgcccggatgaccgcggcggccgcggcg
gtgcggggcctgcgcgccgtcctcgtgctcttcggcgaggcggacgccgcccgggccggc
aacctcgcgctggaggagctgttcggcgcccgggtggtggtcgtcggaccgggcgaggac
gtcgacgcgcgggtcgccgcggtggccgaggagctgcgcggcgacggcgaggtgcccgcg
gtgctgccgctgggcggctcgacgccgaccggtgcgcgcggctacctggcctgcgccgcc
gagctggccgagcagctgcccggcctggacaccgtggtcgtggcggtcggctcgggcggg
acgatggccggcctggtcgccgggctcggcgccgaacgggtgctcggggtggacaccggc
gcggtcgacgaccccgacgtccgggtcaccgccctggccaccgcgctcggcgcgaccgtc
ggcgatctccggctgcgccgggaccaggtgggggcgggctacgggcagctcaccgacgcc
gcggccgccgcgatgaccaccgccgcccgcacccagggcctggtgctcgacccggtctac
accggcaaggcgctggccgggctggccgccgcggtcgccgacggctcggtgcggcccggc
cggcgcacggtcttcctgcacaccggcggcctgccgggcctgttcggccacccgtacgcc
gcgcagctggccggggagctgctcgggcgggcgtga

DBGET integrated database retrieval system