KEGG   Modestobacter marinus: MODMU_4226Help
Entry
MODMU_4226        CDS       T02167                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mmar  Modestobacter marinus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmar00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mmar00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mmar02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4208274..4209593
Genome map
AA seq 439 aa AA seqDB search
MSTSRRRRLQRRTLPLCLAATLVGGGVVVLLPGAASAGGDGRGHPRSVIFVNGDGMAAAH
REAARLDQEGFDGQLAMDSLPIAGLQTTDARDPEDTITDSAASASAWATGVKTYNGAISV
DVDGAPLPTIGQEAQQAGLATGIVTTAQVTDASPAAFFSNSVDRSAQDDIARQYLQVSQP
QVILGGGEDWWLPAGDEGTYAPRAGDTEDPEVSRSTQGDLVAQAEGLGYEYVSTAAEFAA
ADSDQLLGLFANEEMFQQRPEGQGDEFAPVVPLADMTTKALDVLSEDEDGFFLLVEEEAV
DEMSHANNGTRMLQAMRSLDAAVEVAEAYVAEHPDTLLIVTGDHECGGLTIEDVDPEDES
GPGGTLPQETAATGGTESGEDGPFLVAGSEDYDFALDWTTTGHTGAPTVVTAAGPGSEQL
TGYYPNTHLHEVLREVLLG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctcgagaaggcggcgcctgcagcgccgcaccctgccgctctgcctcgccgcg
acgctcgtcggcggtggcgtcgtcgtcctgctgcccggcgcggcgtccgccggcggggac
gggcgcggccacccgcgcagcgtcatcttcgtcaacggcgacggcatggccgccgcgcac
cgggaggccgcccggctggaccaggaggggttcgacggccagctggccatggactccctg
ccgatcgccggcctgcagaccaccgacgcccgggacccggaggacacgatcaccgactcg
gcggcgtccgcgagcgcctgggcgaccggggtgaagacctacaacggtgcgatcagcgtc
gacgtcgacggggccccgctgccgaccatcggccaggaggcgcagcaggccgggttggcc
accggcatcgtgacgacggcgcaggtcaccgacgcgagcccggcggcgttcttcagcaac
tcggtcgaccgcagtgcgcaggacgacatcgcccgccagtacctgcaggtcagccagccg
caggtcatcctgggcggcggcgaggactggtggctgccggccggcgacgagggcacctac
gccccgcgcgccggcgacaccgaggacccggaggtctcccggagcacccagggcgacctg
gtcgcgcaggcggaggggctgggctacgagtacgtgagcaccgccgccgagttcgccgcc
gccgactccgaccagctgctggggctgttcgccaacgaggagatgttccagcagcgccct
gagggccagggcgacgagttcgcccccgtcgtcccgctggcggacatgacgaccaaggcc
ctggacgtcctgtccgaggacgaggacggcttcttcctgctggtcgaggaggaggcggtg
gacgagatgagccacgccaacaacggcacccggatgctccaggcgatgcgctcgctggac
gccgcggtcgaggtcgcggaggcctacgtcgccgagcacccggacacgctgctgatcgtc
accggcgaccacgagtgcggcgggctgaccatcgaggacgtcgacccggaggacgagagc
ggccccggcgggaccctgccgcaggagaccgccgccacgggcggcaccgagtccggtgag
gacggtcccttcctcgtcgccggcagcgaggactacgacttcgccctcgactggacgacg
accgggcacaccggagcgcccaccgtggtgaccgcggcggggccgggcagcgagcagctg
accggctactacccgaacacccacctgcacgaggtcctgcgggaggtgctgctcggctga

DBGET integrated database retrieval system