KEGG   Modestobacter marinus: MODMU_4310Help
Entry
MODMU_4310        CDS       T02167                                 

Gene name
nagZ
Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmar  Modestobacter marinus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MODMU_4310 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MODMU_4310 (nagZ)
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MODMU_4310 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4293465..4294640
Genome map
AA seq 391 aa AA seqDB search
MRRPAPTRTGLLLGVLLAVAGCGGTAPDGATAQSSSAPASSAAPSSSAPAASCADRTLAG
LSLDEQVGQLLMVGVPAADPASGTAALSGVPVGGLFLQGRSSADASSVTASVAELQEGAA
VPLQIAVDQEGGLVQTLKGPGFDRVPTALEQGRQDPAALRSTTAGWAGQLHAAGITMDLG
PVADTVPAGTEADNPPIGAFDRQFGSDPEAVAASVTAVVEGLQDAGVVATAKHFPGLGRV
RVNTDTDLGATDPETSPDDPFLGPFAAAVDAGVGAVMVSSATYPQLDPDSPALFSPAVLD
LLRGQLGFTGVVMSDDVGDAEAVSQTPVAERAVESVAAGVDVVLTVSPADATPMAQALAD
RAADDEAFAGRVTESAGRVLALKERFGLLTC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgaccggcaccgacccgcaccgggctgctcctcggggtcctgctggccgtggcg
gggtgcggcggcacggctccggacggggcgaccgcgcagtcctcctccgcgccggcgtcg
tcggcagcgccgtcgtcgtccgcaccggccgcctcctgcgccgaccggacgctggccggc
ctctccctcgacgagcaggtggggcagctgctgatggtgggggtgcccgcggccgacccg
gcgtccggcaccgccgcgctgtccggcgtgcccgtcggcgggttgttcctgcagggccgc
agctcggccgacgcctcgtcggtgactgcgtccgtcgcggaactccaggagggggccgcc
gtcccgctgcagatcgccgtcgaccaggagggcgggctggtccagacgctcaagggcccc
ggcttcgaccgggtgccgaccgcgctggagcagggccgccaggacccggccgcgctgcgc
tcgacgaccgccggctgggccggtcagctgcacgccgccgggatcaccatggacctgggg
cccgtcgcggacaccgtgcccgccggcacggaggcggacaacccgccgatcggcgccttc
gaccgccagttcggcagcgacccggaggcggtcgcggcgtcggtgaccgcggtggtcgag
gggttgcaggacgccggcgtcgtggccaccgccaagcacttccccgggctgggccgggtc
cgggtgaacaccgacaccgacctgggtgccaccgaccccgagaccagccccgacgacccg
ttcctgggcccgttcgccgccgccgtggacgccggggtcggcgcggtgatggtcagctcg
gcgacctacccgcagctggacccggactcccccgcactgttctcccccgccgtcctggac
ctgctccgcgggcagctgggcttcaccggcgtggtgatgagcgacgacgtcggtgacgcc
gaggcggtgtcgcagaccccggtcgccgagcgggcggtggagtcggttgccgccggggtc
gacgtcgtgctgaccgtcagcccggccgatgccaccccgatggcgcaggccctcgccgac
cgggccgcggacgacgaggcgttcgccggccgggtcaccgagtccgccggccgggtgctg
gcgctcaaggagcggttcggcctgctgacctgctga

DBGET integrated database retrieval system