KEGG   Modestobacter marinus: MODMU_4387Help
Entry
MODMU_4387        CDS       T02167                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase)
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mmar  Modestobacter marinus
Pathway
mmar00900  Terpenoid backbone biosynthesis
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MODMU_4387 (dxr)
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MODMU_4387 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: CCH89771
UniProt: I4F2A8
Position
complement(4371293..4372489)
Genome map
AA seq 398 aa AA seqDB search
MSEPREVTVLGSTGSIGRQAIAVARQNPGRLQVTGLAAGGGDVALLAEQALSLGVRTVAV
ARATAAQDLQLAFYAAAQQRGWAQGHYTLPEILAGPRAAEELAARPADVVLNGITGSIGL
GPTLSALRAGRTVALANKESLVAGGELVKQAAAPGQLVPVDSEHSALAQCLRGGARGEVA
RLVLTASGGPFRGRSAAELAGVTREQALAHPTWDMGPVVTINSATLVNKGLELIEAHLLF
DVPYADIDVVVHPQSIVHSMVTFADGATIAQASPPDMRLPIALALAWPDRLPDVQPALDW
SQASTWEFMPLDSEVFPAVRLARQAGEAGGVVPALFNAANEEAVAAFAAGHLAFTAIVQV
IARTLDAAPDLGAPTCVEDVLAAEKWAREHARVAIAGG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagccgcgcgaggtcaccgtgctggggtcgaccgggtccatcgggcggcaggcg
atcgccgtcgcccggcagaacccggggcggctgcaggtcaccgggctggcggccgggggc
ggtgacgtcgcgctgctggccgagcaggcgctgagcctcggcgtccggacggtcgcggtc
gcccgcgccaccgccgcgcaggacctgcagctggcgttctacgccgccgcccagcagcgc
ggctgggcgcagggccactacacgctcccggagatcctggccggcccgcgggccgccgag
gagctcgccgcccggccggccgacgtcgtgctcaacgggatcaccggctcgatcgggctg
gggccgaccctctcggcgctgcgcgccgggcgcaccgtcgcgctggccaacaaggagtcc
ctggtcgccggcggtgagctggtgaagcaggccgccgcgcccggccagctggtcccggtc
gactccgagcactccgcgctggcccagtgcctgcgcggcggcgcgcgcggcgaggtcgcc
cggctggtgctcaccgccagcggcggaccgttccgcggccgctccgccgccgagctggcc
ggggtcacccgcgagcaggcgctggcccaccccacctgggacatgggaccggtggtcacc
atcaactccgcgaccctggtcaacaagggcctggagctgatcgaggcccacctgctcttc
gacgtcccctacgccgacatcgacgtggtggtgcacccgcagtcgatcgtgcactccatg
gtgaccttcgccgacggcgccaccatcgcccaggccagcccgccggacatgcggctgccc
atcgcgctggcgctggcctggcccgaccgcctgccggacgtgcagccggcgctggactgg
tcgcaggcgagcacctgggagttcatgccgctggactccgaggtgttccccgcggtgcgg
ctcgcccggcaggcgggtgaggcgggcggcgtcgtcccggccctgttcaacgcggccaac
gaggaggcggtcgccgcattcgccgccggacacctcgcgttcacagccatcgtgcaggtc
atcgcgcgtaccttggacgccgcgccggacctcggcgcacccacctgcgtcgaggacgtg
ctggccgctgagaagtgggcccgggagcacgcccgcgtcgccatcgccggaggctga

DBGET integrated database retrieval system