KEGG   Modestobacter marinus: MODMU_4516Help
Entry
MODMU_4516        CDS       T02167                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmar  Modestobacter marinus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmar00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4510109..4513225
Genome map
AA seq 1038 aa AA seqDB search
MTIDDTQPPGTDTPDQPADRAELTRRVEEKTAAVQAAAEPPAKRARKAAKKAAPAADGTA
APAPAKRTRKAAATPAAEAAPGATDDVAPAKRTRKAAAKKAAPALDDAAPAPAKRTRKAA
AKKVTATPVVAPAPIAQPGDPTAPSAPQPEPPSPDPAEPSTPQAPEDGRHAGTGGSSPAQ
TASEPGAELAPDTVPADRPGTDPATGTAQGPGAVPGEVTGADVTTADLATSEVPDLPPAP
DQAPAPAAAGLVAALPEGEAPVSTSVPAEATPSGSEVSDEQFAAVVDGWSFDPHGVLGAH
RLAEGWAVRTLRPDAVAVVVVDQDGSRYEASPVFRGGVFEARLPQQPGDYRIEVGYPNAD
GGTDTFLVDDPYRWLPTLGEVDQHLIREGRHEKLWTVLGAHVRGYDTPGGRVEGVSFAVW
APNARGVKVTGDFDYWEARAYPLRSLGASGVWEIFVPGAQVGTRYRYHVLGADGQWRVKS
DPLAFATEVPPSNASVVTASAHEWHDDQWLAARAEGNWHQRPISVYEVHAGSWRQGLSYR
DMADELVAYVKDAGFTHLEFMPLAEHPFGGSWGYQVTSYYAPTSRFGSPDDLRYLIDTAH
QAGIGVIVDWVPAHFPKDEWALARFDGTALYEHPDPRRGEQPDWGTYVFDFGRNEVRNFL
VANALFWAQEFHVDGIRVDAVASMLYLDYSRNEGEWTPNQYGGRENLEAVSFLQEMNATL
YREVPGVVSIAEESTAWPGVTRPTYLGGLGFGFKWNMGWMHDSLGYMSKQPVYRSFHHSQ
LTFSLVYAFSENYVLPISHDEVVYGKGSLIRKMPGDRWQQLANLRAFLGYMWAHPGKQLL
FMGSEFGQLSEWAESRSLDWWHLDDPAHRGVLDLVRDLNTVYKDTEALWSQDVDPAGFQW
IDANDAGGNTLTFLRYGKDGQVLACVANFSGTPHHDFRIGLPRGGRWRELINTDFEGYGG
SGVGNLGGVDAVAQSWHGQPYSAALTAPPLATVWFVHEGPEPAAADDGAPADARHSAAAE
ASGQAEGPGSGLEPAQEG
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgacgacacgcagcctccgggcaccgacacccccgaccagccggccgaccgg
gccgagctgacccggcgggtcgaggagaagaccgccgccgtgcaggccgcggccgagccc
ccggcgaagagggcccgcaaggccgcgaagaaggccgccccggcagccgacggcaccgcc
gccccggcgcctgcgaagcggacccgcaaggccgccgccaccccggcggccgaggccgcg
ccgggcgcgaccgacgacgtcgccccggccaagcggacccgcaaggccgccgccaagaag
gccgccccggccctggacgacgcggcgcccgccccggcgaagcggacccgcaaggccgcg
gcgaagaaggtcaccgcgaccccggtcgtcgccccggccccgatcgcccagccgggcgac
ccgacggccccctcggcaccccagccggagccgccgagcccggacccggccgagcccagc
accccgcaggcacccgaggacggccggcacgccggcaccggcggcagctcgccggcgcag
accgcctccgagcccggtgccgagctggccccggacacggtgcccgcggaccgtcccggg
accgacccggcgaccggcaccgcgcagggtcccggcgccgtccccggtgaggtgaccggg
gccgacgtcaccaccgccgacctggcgaccagcgaggttcccgatctgcccccggcaccc
gaccaggcgcccgcgccggccgccgccgggctggtggccgcgctgcccgagggcgaggcg
ccggtgagcacctcggtgcccgccgaggccaccccgtccggcagcgaggtcagcgacgag
cagttcgccgccgtcgtcgacggctggtccttcgacccgcacggcgtcctcggggcgcac
cggctggccgagggctgggcggtccgcacgctgcggcccgacgcggtcgccgtcgtcgtc
gtcgaccaggacggcagccgctacgaggcgagcccggtcttccggggcggcgtcttcgag
gcccggctgccgcagcagcccggcgactaccggatcgaggtcggctacccgaacgccgac
ggcgggaccgacaccttcctcgtcgacgacccgtaccgctggctgcccaccctcggcgag
gtcgaccagcacctcatccgcgagggccggcacgagaagctgtggacggtgctgggcgcg
cacgtgcgcggctacgacacccccggcggccgcgtcgagggcgtctcgttcgccgtctgg
gcgcccaacgcgcgcggcgtgaaggtcaccggcgacttcgactactgggaggcccgcgcc
tacccgctgcgctcgctgggcgcctcgggggtgtgggagatcttcgtgcccggcgcccag
gtgggcacccggtaccggtaccacgtcctgggcgccgacgggcagtggcgggtcaagagc
gacccgctggcgttcgccaccgaggtcccgccgtccaacgcctcggtggtcaccgcctcc
gcccacgagtggcacgacgaccagtggctggccgcccgcgccgagggcaactggcaccag
cggccgatcagcgtctacgaggtgcacgccggttcctggcggcagggcctctcctaccgg
gacatggccgacgagctcgtcgcctacgtcaaggacgccgggttcacccacctggagttc
atgccgctggccgagcaccccttcggcggctcgtggggctaccaggtcacctcctactac
gccccgacgtcgcggttcggctcccccgacgacctgcggtacctcatcgacaccgcccac
caggccggcatcggcgtcatcgtcgactgggtgcccgcacacttccccaaggacgagtgg
gcgctggcccgcttcgacggcacggcgctgtacgagcacccggacccgcgccgcggggag
cagccggactggggcacctacgtcttcgacttcggccgcaacgaggtgcgcaacttcctg
gtcgccaacgcgctgttctgggcccaggagttccacgtcgacggcatccgcgtcgacgcc
gtcgcctcgatgctgtacctggactactcgcgcaacgagggcgagtggacgccgaaccag
tacggcggccgggagaacctcgaggcggtgtcgttcctgcaggagatgaacgcgacgctg
taccgcgaggtgccgggcgtggtgtccatcgccgaggagtcgaccgcgtggccgggcgtc
acccggcccacctacctgggcggcctgggcttcggcttcaagtggaacatgggctggatg
cacgactcgctgggctacatgtccaagcagccggtgtaccgcagcttccaccacagccag
ctcacgttctccctggtctacgcgttctcggagaactacgtcctgccgatcagccacgac
gaggtcgtctacggcaagggctcgctcatccggaagatgcccggcgaccggtggcagcag
ctggccaacctgcgggccttcctgggctacatgtgggcccacccgggcaagcagctgctg
ttcatgggctcggagttcggccagctgtcggagtgggcggagagccggtcgctggactgg
tggcacctcgacgacccggcgcaccggggcgtcctggacctggtccgggacctcaacacc
gtctacaaggacaccgaggcgctctggtcgcaggacgtcgaccccgcgggcttccagtgg
atcgacgccaacgacgccggcggcaacacgctgaccttcctgcgctacggcaaggacggc
caggtgctggcctgcgtggccaacttctccgggacgccgcaccacgacttccggatcggg
ctgccccgcggtggccggtggcgtgagctgatcaacaccgacttcgagggctacggcggc
tccggcgtcggcaacctcggcggcgtcgacgccgtcgcccagagctggcacgggcagccg
tactcggcggcgctgaccgcgccgccgctggccacggtgtggttcgtgcacgaggggccg
gagccggcggccgccgacgacggcgcgccggccgacgcgcggcacagcgccgcggccgag
gcctccgggcaggccgagggcccgggctccgggctggagccggcccaggagggctga

DBGET integrated database retrieval system