KEGG   Modestobacter marinus: MODMU_4558Help
Entry
MODMU_4558        CDS       T02167                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmar  Modestobacter marinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MODMU_4558 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MODMU_4558 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MODMU_4558 (thrC)
Enzymes [BR:mmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MODMU_4558 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4553025..4554110)
Genome map
AA seq 361 aa AA seqDB search
MTGAHTLRGAVSPYWPGLIEAYRDRLPVSASTPVVTLQEGATPLVPAPELSRRTGCEVYL
KVEGANPTGSFKDRGMTMAITKAVEEGAQAVICASTGNTSASAAAYAARAGLVCAVLVPQ
GKIATGKLAQALVHGAKLLQVEGNFDDCLALASKLAIDYPVSLVNSVNQYRIEGQKTASF
EIVDVLGDAPDVHCLPVGNAGNITAYWQGYREYAADGPATRTPRMWGFQAAGAAPIVSGK
VVPHPETIATAIRIGNPASWTKALAARDDSGGRIDAVTDRAILAAYRLLARTEAVFVEPA
SAASVAGLLQVAEAGGLERGQRVVCTVTGNGLKDPEWAISGAPAPVTIPVDSAAAAAQLG
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccggagcacacaccctgcgaggtgccgtctcgccgtactggcctggcctgatcgag
gcctaccgggaccggctgccggtgagcgcctcgacgccggtggtcacgctgcaggagggc
gcgaccccgctggtgcccgcaccggagctgtcccgccgcaccggctgcgaggtgtacctc
aaggtcgagggcgcgaacccgaccggctcgttcaaggaccgcggcatgaccatggccatc
accaaggccgtggaggagggcgcgcaggcggtgatctgcgcgtccaccggcaacaccagc
gccagcgccgcggcgtacgcggcccgggccgggctggtctgcgccgtgctggtgccgcag
gggaagatcgccaccggcaagctcgcccaggcgctggtgcacggcgccaagctgctgcag
gtcgagggcaacttcgacgactgcctcgcgctggccagcaagctcgccatcgactacccg
gtgagcctggtcaacagcgtgaaccagtaccgcatcgaggggcagaagacggcgtcgttc
gagatcgtcgacgtcctcggcgacgcccccgacgtgcactgcctgccggtcggcaacgcc
ggcaacatcaccgcctactggcagggctaccgcgagtacgccgcggacggcccggccacg
cgcacgccgcggatgtggggcttccaggccgccggtgccgcgccgatcgtgtccggcaag
gtcgtcccgcacccggagacgatcgccaccgccatccggatcgggaacccggcgtcctgg
accaaggcgctggccgcccgggacgactccggcggccggatcgacgcggtcaccgaccga
gcgatcctcgccgcctaccggctgctcgcccgcaccgaggccgtcttcgtcgagccggcg
tccgcggcgtcggtcgccgggctgctgcaggtcgccgaggccggcgggctcgagcgcggc
cagcgggtggtctgcaccgtcaccggcaacggcctcaaggaccccgagtgggcgatctcc
ggcgccccggcgccggtcaccatcccggtggactccgccgcggccgccgcgcagctgggc
ctctga

DBGET integrated database retrieval system