KEGG   Modestobacter marinus: MODMU_4703Help
Entry
MODMU_4703        CDS       T02167                                 

Definition
F420-dependent oxidoreductase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mmar  Modestobacter marinus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MODMU_4703
Enzymes [BR:mmar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     MODMU_4703
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     MODMU_4703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4696973..4698040
Genome map
AA seq 355 aa AA seqDB search
MSEPPAGISVHPVPGLPEFGPGDDLAGALAGAAPWLADGDVLVVTSKVVAKVEGALVRVE
PGTDREAARQRAIDAETVRVVARRGPLRIVETRHGWVVAAAGIDASNVASDALVLLPEDA
DASARLLRARLRELLGVTVGVVVSDTFGRPWRDGVSDVAIGAAGLPALVDHRGAVDAHGN
RLETTQVAVVDELAAAGDLVKGKLAGLPVAVVRGLALPAPDPDPGTRPLVRLGPGDLFSA
GTRDVVAGRAPADRLTARAGALAAATDAFRVAVAALPEFPVVFRYGPEEDGDDGDVIDVH
LAEPVTPRAALAVGAIVGAALVQLSAEGWATRWQPVATLGGSGLVGRLRMGASPA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagccgccggccggcatctcggtccacccggtgccggggctgccggagttcggc
cccggtgacgacctggccggggcgctcgccggcgcggccccgtggctggccgacggcgac
gtgctggtggtcacctcgaaggtcgtggccaaggtcgagggcgccctcgtccgggtcgag
cccggcaccgaccgggaagccgcccggcagcgggccatcgacgccgagacggtccgcgtg
gtcgcccgccgcggaccgctgcggatcgtggagacccggcacggctgggtggtggccgcc
gccggcatcgacgcctccaacgtcgccagcgacgcgctggtcctgctgcccgaggacgcc
gacgcctccgcccggctgctccgcgcccggctccgcgaactgctcggcgtcacggtcggc
gtcgtggtcagcgacaccttcggccggccctggcgggacggcgtcagcgacgtggcgatc
ggcgccgccgggctgcccgcgctggtcgaccaccgcggcgccgtcgacgcccacggcaac
cggctggagaccacccaggtggccgtggtcgacgagctggccgcggccggcgacctggtg
aagggcaagctcgccgggctgccggtggcggtcgtccgcggcctggccctccctgccccg
gaccccgaccccggcacccggccgctggtccggctgggcccgggcgacctgttcagcgcc
ggcacccgcgacgtcgtcgccggccgcgcgccggccgaccggctcaccgcccgggccggc
gccctggccgcggccaccgacgcgttccgggtcgccgtggccgcgctgcccgagttcccc
gtcgtcttccgctacggacccgaggaggacggcgacgacggcgacgtgatcgacgtccac
ctcgccgagccggtgaccccccgggccgccctcgccgtcggcgcgatcgtcggtgcggcg
ctggtccagctctccgccgagggctgggcgacccgctggcagccggtggccaccctgggc
ggcagcgggctggtcggccggctgcggatgggcgcctcccccgcctga

DBGET integrated database retrieval system