KEGG   Modestobacter marinus: MODMU_4992Help
Entry
MODMU_4992        CDS       T02167                                 

Gene name
hemB
Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mmar  Modestobacter marinus
Pathway
mmar00860  Porphyrin and chlorophyll metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01120  Microbial metabolism in diverse environments
Module
mmar_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MODMU_4992 (hemB)
Enzymes [BR:mmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MODMU_4992 (hemB)
Exosome [BR:mmar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MODMU_4992 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMS28_porin
Motif
Other DBs
NCBI-ProteinID: CCH90372
UniProt: I4F409
Position
complement(4987529..4988524)
Genome map
AA seq 331 aa AA seqDB search
MTSGGGANPGFARGRRLRSTPAMRRWTAQTRLAPADFVLPVFVKEGLTDPQPISSMPGVV
QHSLDSLRKAAHEAAEAGISGLMLFGIPAEKDAVGSQADAADGIVNVALQQLRADLGDEL
VLMADLCLCEYTDHGHCGVITPAGVVDNDPTLDRYAAVAIAQARAGAHVIAPSGMMDGQV
AAIRAGLDSSAYTETPVLAYAAKYASGFYGPFREAAEGAPQFGDRSTYQMDPPNADEALR
EVAQDLAEGADAVMVKPALPYLDIVSKVADAVDVPVSAYQVSGEYAMIEAAAAHGWIDRR
RAVLETLTAIRRAGAGSVLTYWAVEAARWLR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccgggggcggcgcgaacccggggttcgcgcggggccgccggctccgctcgacc
ccggccatgcggcgctggacggcgcagacccggctggcccccgccgacttcgtgctgccc
gtcttcgtcaaggaggggctgaccgacccgcagccgatctcctcgatgcccggcgtcgtg
cagcactcgctggactcgctgcgcaaggccgcgcacgaggccgcggaggccggcatcagc
gggctgatgctgttcggcatcccggcggagaaggacgcggtcggctcgcaggccgacgcc
gccgacgggatcgtcaacgtcgccctgcagcagctgcgggccgacctcggcgacgagctg
gtgctgatggccgacctctgcctgtgcgagtacaccgaccacgggcactgcggcgtcatc
accccggccggcgtcgtcgacaacgacccgacgctggaccgctacgccgcggtcgccatc
gcgcaggcccgggccggcgcccacgtcatcgcccccagcgggatgatggacgggcaggtc
gccgcgatccgggccgggctggactccagcgcctacaccgagaccccggtgctggcctac
gccgccaagtacgcgtcgggcttctacgggccgttccgggaggccgccgagggggcgccg
cagttcggcgaccgctcgacctaccagatggacccgcccaacgccgacgaggcgctgcgc
gaggtggcgcaggacctcgccgagggcgcggacgccgtcatggtcaagccggcgctgccg
tacctggacatcgtctcgaaggtcgccgacgccgtcgacgtcccggtcagcgcctaccag
gtcagcggcgagtacgcgatgatcgaggccgccgccgcgcacggctggatcgaccgccgc
cgggccgtgctggagaccctcaccgcgatccgccgggccggggccgggtcggtgctgacc
tactgggcggtcgaggccgcccgctggctccgctga

DBGET integrated database retrieval system