KEGG   Modestobacter marinus: MODMU_5170Help
Entry
MODMU_5170        CDS       T02167                                 

Gene name
aceB
Definition
(RefSeq) Malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mmar  Modestobacter marinus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MODMU_5170 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MODMU_5170 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MODMU_5170 (aceB)
Enzymes [BR:mmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MODMU_5170 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5156920..5158521
Genome map
AA seq 533 aa AA seqDB search
MSTVDGVEITGPMGPRFEEVLTPQALELIARLHRELNGRRLERLQARTERVQALADGGTL
DFLPETASIREDDSWRVAPPAPGLVDRRVEMTGPTDRKMTINALNSGAKCWLADQEDANS
PLWENVVNGPLNLMDSIDRTIDFTSPQGKSYELKPDDELPTIIVRPRGWHLPEKHITVDG
EQTSGSLVDFALYLVSCGKKQVDRGQGPYFYLPKMESHLEARLWNDAFVIGQEHVGIPRG
TIRATCLIETYPAAFEMEEILYELREHSSGLNAGRWDYLFSVIKTFRTRGADFTLPDRNS
ITMTVPFMRAYTELLVRTCHKRGAHAMGGMSAFIPSKDPAKNEFAFNKITEDKTREANDG
FDGSWVAHPGMVQTAMDAFDKVLGDRPNQLDKLREDVHVTAADLLNVKATPGEVTEAGLR
ANVSVGIQYVESWLRGSGAAGINGLMEDAATAEISRSQVWQWLHNGVTLSDGQPVTTELV
QRVIEEEVAAIASAKGDAYSSGRWDDARALFTEMALGDEYNDFLTVPAYERMP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggtcgacggcgtcgagatcaccggtccgatgggcccgcggttcgaggaggtc
ctgaccccccaggcgctcgagctgatcgcccggctgcaccgggagctcaacggccgacgg
ctggagcggctgcaggcacgcaccgagcgggtgcaggccctcgccgacggcggcacgctg
gacttcctgcccgagaccgcctccatccgcgaggacgactcctggcgggtcgcgccgccg
gcccccggcctggtcgaccgccgggtggagatgaccggtccgaccgaccgcaagatgacc
atcaacgcgctcaactctggcgccaagtgctggctggccgaccaggaggacgccaactcc
ccgctgtgggagaacgtcgtcaacggcccgctgaacctgatggactccatcgaccgcacc
atcgacttcaccagcccgcaggggaagtcctacgagctcaagccggacgacgagctgccc
acgatcatcgtccggccgcgcggctggcacctgccggagaagcacatcaccgtcgacggc
gagcagacctccggcagcctggtcgacttcgcgctctacctggtcagctgcggcaagaag
caggtcgaccgcggccaggggccgtacttctacctgccgaagatggagagccacctcgag
gcgcggctgtggaacgacgcgttcgtcatcggccaggagcacgtcggcatcccgcgcggc
accatccgggcgacctgcctgatcgagacctacccggcggcgttcgagatggaggagatc
ctctacgagctccgcgagcactcctccgggctcaacgccggccgctgggactacctgttc
agcgtgatcaagaccttccgcacccgcggcgcggacttcacgctgccggaccggaactcg
atcacgatgaccgtgccgttcatgcgcgcctacaccgagctgctggtgcgcacctgccac
aagcgcggcgcgcacgccatgggcggcatgtccgcgttcatcccgagcaaggacccggcg
aagaacgagttcgcgttcaacaagatcaccgaggacaagacccgcgaggccaacgacggc
ttcgacggctcctgggtggcgcacccgggcatggtgcagaccgcgatggacgccttcgac
aaggtgctcggcgaccggccgaaccagctggacaagctgcgcgaggacgtgcacgtcacc
gccgcggacctgctcaacgtcaaggccacccccggtgaggtcaccgaggccgggctgcgg
gccaacgtcagcgtcggcatccagtacgtggagtcgtggctgcgcggctccggcgcggcc
ggcatcaacggcctgatggaggacgccgccaccgccgagatcagccgcagccaggtgtgg
cagtggctgcacaacggggtgacgctgtccgacgggcagccggtcaccaccgagctggtg
cagcgggtgatcgaggaggaggtcgcggccatcgcctcggccaagggagatgcgtactcc
tccggccggtgggacgatgcccgcgcgctgttcaccgagatggccctgggggacgagtac
aacgacttcctgaccgtcccggcctacgagcgcatgccctga

DBGET integrated database retrieval system