KEGG   Modestobacter marinus: MODMU_5170Help
Entry
MODMU_5170        CDS       T02167                                 

Gene name
aceB
Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mmar  Modestobacter marinus
Pathway
mmar00620  Pyruvate metabolism
mmar00630  Glyoxylate and dicarboxylate metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01120  Microbial metabolism in diverse environments
mmar01200  Carbon metabolism
Module
mmar_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MODMU_5170 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MODMU_5170 (aceB)
Enzymes [BR:mmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MODMU_5170 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CCH90548
UniProt: I4F4I5
Position
5156920..5158521
Genome map
AA seq 533 aa AA seqDB search
MSTVDGVEITGPMGPRFEEVLTPQALELIARLHRELNGRRLERLQARTERVQALADGGTL
DFLPETASIREDDSWRVAPPAPGLVDRRVEMTGPTDRKMTINALNSGAKCWLADQEDANS
PLWENVVNGPLNLMDSIDRTIDFTSPQGKSYELKPDDELPTIIVRPRGWHLPEKHITVDG
EQTSGSLVDFALYLVSCGKKQVDRGQGPYFYLPKMESHLEARLWNDAFVIGQEHVGIPRG
TIRATCLIETYPAAFEMEEILYELREHSSGLNAGRWDYLFSVIKTFRTRGADFTLPDRNS
ITMTVPFMRAYTELLVRTCHKRGAHAMGGMSAFIPSKDPAKNEFAFNKITEDKTREANDG
FDGSWVAHPGMVQTAMDAFDKVLGDRPNQLDKLREDVHVTAADLLNVKATPGEVTEAGLR
ANVSVGIQYVESWLRGSGAAGINGLMEDAATAEISRSQVWQWLHNGVTLSDGQPVTTELV
QRVIEEEVAAIASAKGDAYSSGRWDDARALFTEMALGDEYNDFLTVPAYERMP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggtcgacggcgtcgagatcaccggtccgatgggcccgcggttcgaggaggtc
ctgaccccccaggcgctcgagctgatcgcccggctgcaccgggagctcaacggccgacgg
ctggagcggctgcaggcacgcaccgagcgggtgcaggccctcgccgacggcggcacgctg
gacttcctgcccgagaccgcctccatccgcgaggacgactcctggcgggtcgcgccgccg
gcccccggcctggtcgaccgccgggtggagatgaccggtccgaccgaccgcaagatgacc
atcaacgcgctcaactctggcgccaagtgctggctggccgaccaggaggacgccaactcc
ccgctgtgggagaacgtcgtcaacggcccgctgaacctgatggactccatcgaccgcacc
atcgacttcaccagcccgcaggggaagtcctacgagctcaagccggacgacgagctgccc
acgatcatcgtccggccgcgcggctggcacctgccggagaagcacatcaccgtcgacggc
gagcagacctccggcagcctggtcgacttcgcgctctacctggtcagctgcggcaagaag
caggtcgaccgcggccaggggccgtacttctacctgccgaagatggagagccacctcgag
gcgcggctgtggaacgacgcgttcgtcatcggccaggagcacgtcggcatcccgcgcggc
accatccgggcgacctgcctgatcgagacctacccggcggcgttcgagatggaggagatc
ctctacgagctccgcgagcactcctccgggctcaacgccggccgctgggactacctgttc
agcgtgatcaagaccttccgcacccgcggcgcggacttcacgctgccggaccggaactcg
atcacgatgaccgtgccgttcatgcgcgcctacaccgagctgctggtgcgcacctgccac
aagcgcggcgcgcacgccatgggcggcatgtccgcgttcatcccgagcaaggacccggcg
aagaacgagttcgcgttcaacaagatcaccgaggacaagacccgcgaggccaacgacggc
ttcgacggctcctgggtggcgcacccgggcatggtgcagaccgcgatggacgccttcgac
aaggtgctcggcgaccggccgaaccagctggacaagctgcgcgaggacgtgcacgtcacc
gccgcggacctgctcaacgtcaaggccacccccggtgaggtcaccgaggccgggctgcgg
gccaacgtcagcgtcggcatccagtacgtggagtcgtggctgcgcggctccggcgcggcc
ggcatcaacggcctgatggaggacgccgccaccgccgagatcagccgcagccaggtgtgg
cagtggctgcacaacggggtgacgctgtccgacgggcagccggtcaccaccgagctggtg
cagcgggtgatcgaggaggaggtcgcggccatcgcctcggccaagggagatgcgtactcc
tccggccggtgggacgatgcccgcgcgctgttcaccgagatggccctgggggacgagtac
aacgacttcctgaccgtcccggcctacgagcgcatgccctga

DBGET integrated database retrieval system