KEGG   Modestobacter marinus: MODMU_5225Help
Entry
MODMU_5225        CDS       T02167                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mmar  Modestobacter marinus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mmar00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mmar00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5208889..5209644
Genome map
AA seq 251 aa AA seqDB search
MASSEPLSGRRAMVTGGASGIGRACAVRLAAAGAAVVVLDRDAAAAQAVADQVGGTAVTV
DLTDLDAIDRLDLDVDVLVNNAGLQHVAPLHEFPVDRFSAMLRLMLEAPFRLVRGVLPGM
YERGWGRVVNVSSVHGLRASPYKVAYVTAKHGLEGLSKVVALEGAEHGVTSNCVNPAYVR
TPLVEGQIADQARAHGLTEDEVVEQVMLAPAALKRLIEPEEVADAVAWLCSPAATSVTGS
SLVMDGGWTAH
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccgagcccctgtccgggcgacgcgcgatggtgaccggcggtgcgtccggg
atcgggcgggcctgcgcggtccggctggccgccgcgggtgcggcggtcgtcgtcctcgac
cgggacgcggcggccgcgcaggcggtcgccgaccaggtgggcggcaccgccgtcacggtc
gacctgaccgacctggacgcgatcgaccggctggacctcgacgtcgacgtgctggtcaac
aacgcggggctgcagcacgtcgcaccgctgcacgagttcccggtcgaccggttcagcgcc
atgctgcggctgatgctggaggccccgttccggctggtccggggcgtgctgccggggatg
tacgagcgcggctggggccgggtggtcaacgtgagctcggtgcacggcctgcgcgcgtcg
ccctacaaggtcgcctacgtcaccgccaagcacggcctggagggcctgtccaaggtcgtc
gcgctggagggcgcggagcacggcgtcacgtccaactgcgtcaaccccgcctacgtccgg
acgccgctggtggagggccagatcgccgaccaggcgcgcgcccacgggctgaccgaggac
gaggtcgtcgagcaggtgatgctggcgccggccgcgctcaagcggctgatcgagcccgag
gaggtcgccgacgccgtcgcgtggctgtgctccccggccgcgacctcggtgaccggcagc
tcgctggtgatggacggcgggtggaccgcccactga

DBGET integrated database retrieval system