KEGG   Modestobacter marinus: MODMU_5292Help
Entry
MODMU_5292        CDS       T02167                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mmar  Modestobacter marinus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmar00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mmar00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5276272..5276766
Genome map
AA seq 164 aa AA seqDB search
MSDLLDLPVTTLAGEPTTLGALTAGRAALVVNVASRCGLTPQYAQLEELHEEYAARGFTV
LGVPCNQFAGQEPGTAEEISTFCSATYGITFPMTEKLEVNGDDAAPLYRRLTEVPDAAGE
AGPVQWNFEKFVIDAQGQVVGRFRPRTEPTAPEVRAAVEAALAG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacctgctggacctgcccgtgaccaccctcgccggggagccgacgaccctcggc
gcgctgaccgccgggcgggccgccctggtggtcaacgtggccagccgctgcgggctcacc
ccgcagtacgcccagctggaggagctgcacgaggagtacgccgcccgcgggttcaccgtg
ctcggcgtgccgtgcaaccagttcgccggccaggagccgggcacggccgaggagatcagc
accttctgctcggccacctacgggatcaccttcccgatgaccgagaagctggaggtcaac
ggggacgacgccgcgccgctctaccgccggctcaccgaggtgcccgacgccgcgggcgag
gccgggccggtgcagtggaacttcgagaagttcgtgatcgacgcacaggggcaggtcgtc
ggccgcttccggccgcgcaccgagcccaccgcccccgaggtccgtgccgccgtcgaggcc
gcgctcgccgggtga

DBGET integrated database retrieval system