KEGG   Modestobacter marinus: MODMU_5292Help
Entry
MODMU_5292        CDS       T02167                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mmar  Modestobacter marinus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MODMU_5292
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MODMU_5292
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MODMU_5292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5276272..5276766
Genome map
AA seq 164 aa AA seqDB search
MSDLLDLPVTTLAGEPTTLGALTAGRAALVVNVASRCGLTPQYAQLEELHEEYAARGFTV
LGVPCNQFAGQEPGTAEEISTFCSATYGITFPMTEKLEVNGDDAAPLYRRLTEVPDAAGE
AGPVQWNFEKFVIDAQGQVVGRFRPRTEPTAPEVRAAVEAALAG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacctgctggacctgcccgtgaccaccctcgccggggagccgacgaccctcggc
gcgctgaccgccgggcgggccgccctggtggtcaacgtggccagccgctgcgggctcacc
ccgcagtacgcccagctggaggagctgcacgaggagtacgccgcccgcgggttcaccgtg
ctcggcgtgccgtgcaaccagttcgccggccaggagccgggcacggccgaggagatcagc
accttctgctcggccacctacgggatcaccttcccgatgaccgagaagctggaggtcaac
ggggacgacgccgcgccgctctaccgccggctcaccgaggtgcccgacgccgcgggcgag
gccgggccggtgcagtggaacttcgagaagttcgtgatcgacgcacaggggcaggtcgtc
ggccgcttccggccgcgcaccgagcccaccgcccccgaggtccgtgccgccgtcgaggcc
gcgctcgccgggtga

DBGET integrated database retrieval system