KEGG   Modestobacter marinus: MODMU_5533Help
Entry
MODMU_5533        CDS       T02167                                 

Gene name
argE
Definition
(GenBank) Acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmar  Modestobacter marinus
Pathway
mmar00300  Lysine biosynthesis
mmar01100  Metabolic pathways
mmar01120  Microbial metabolism in diverse environments
mmar01230  Biosynthesis of amino acids
Module
mmar_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MODMU_5533 (argE)
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MODMU_5533 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: CCH90902
UniProt: I4F5I9
Position
complement(5506329..5507402)
Genome map
AA seq 357 aa AA seqDB search
MDVVGLVRELVGRPTVSGDAAAQRGLLGTVTDVLTAAAPHLRVQEGADREQPWTLLTSAT
DPARPRLLVACHVDTVPAADPAGWQRDPFGAELDGGRVWGRGGSDMKAGLVAAAAAVAGA
DPAVPVALLLTSDEEIGSRGAAAAAGEVADLAVGAVVVPEATGNRVVLGHRGALWLAVRT
AGVAAHGSTPERGHNALLDLVAVLGRAGGGLPLATEPFLGSETWNPGVLRSGTVANVVPD
RAEVVVDQRTVGDGSALLAWWRAQPEVAGVEVLVDLPPVRTPADDPWVAGLPAPVEPSPA
TYFTDASVLGQVTGAAPVVVWGPGTPAVMHATDEYVEVAEVEQAVTALSAVLGAWPS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtcgggctggtccgggagctggtcgggcggccgacggtctccggggacgcc
gccgcgcagcgcgggctgctgggcacggtcaccgacgtgctcaccgcggcggcgccgcac
ctgcgggtgcaggagggggccgaccgggagcagccctggaccctgctgacctcggccacc
gacccggcgcggccgcggctgctggtggcctgccacgtcgacacggtgcccgccgccgac
cccgccggctggcagcgggacccgttcggcgccgagctggacggcggccgggtctggggc
cgcggcggctcggacatgaaggccggtctggtggccgccgcggcggcggtggccggtgcc
gaccccgccgtcccggtcgcgctgctgctgaccagcgacgaggagatcgggtcccggggc
gcggcggcggccgccggggaggtggccgacctggcggtcggtgcggtcgtcgtcccggag
gcgaccgggaaccgggtcgtgctgggccaccgcggcgcgctgtggctggcggtccgcacc
gcgggggtcgccgcgcacggcagcacgcccgagcgcgggcacaacgcgctgctggacctg
gtcgccgtgctgggtcgggccgggggtgggctgccgctggccaccgagcccttcctgggg
tccgagacctggaacccgggcgtgctgcgcagcggcaccgtggccaacgtcgtcccggac
cgggccgaggtggtcgtcgaccagcggaccgtcggggacggcagcgccctgcttgcctgg
tggcgcgcgcagccggaggtcgccggggtcgaggtgctggtcgacctgccgccggtccgc
accccggccgacgacccgtgggtcgccgggctgcccgcgccggtcgagccctcccccgcc
acctacttcaccgacgcgtcggtgctcgggcaggtcaccggcgcggcgccggtcgtggtc
tggggcccggggacgccggcggtcatgcacgccaccgacgagtacgtcgaggtggccgag
gtcgagcaggccgtcaccgcgctctccgccgtcctcggcgcctggcccagctga

DBGET integrated database retrieval system