KEGG   Modestobacter marinus: MODMU_5539Help
Entry
MODMU_5539        CDS       T02167                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mmar  Modestobacter marinus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mmar00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5512450..5513967
Genome map
AA seq 505 aa AA seqDB search
MSQYVAAIDQGTTSTRCMLFDHDGAVVSVGQKEHEQIFPRAGWVEHDPMEIWTNTREVVG
QALARGNASNSDIVAVGITNQRETTVVWDRTTGRPVYNAIVWQDTRTTAIVEQLGALGGG
ADRYKDKVGLPLATYFAGPKVRWILDNVDGAREAAERGDLLMGTIDSWLIWNMTGGTDGG
LHLTDVSNASRTMLMDYRTLAWDAAIAEEMGIPMSMLPEIRSNSEEYGVGRKSGFLAGVP
IAGSLGDQQAATFGQVCFTKGMAKNTYGTGNFMLLNTGEEAVPSKNGLLTTLCYQLGDAK
PVYALEGSIAVTGSLVQWVRDNLKMISSAPEIEDLAREVDDNGGSYFVPAFSGLFAPHWR
SDARGAVVGLTRFVNRGHLARAVLEATAYQTREVLDAMNADSGVDLTELRVDGGMVGNEL
LMQFQADILDVPVIRPKIAETTALGAAYAAGLAVGFWSDLDELTAKWAEDKRWEPQMATE
DRERYYRNWQKAVTKSLDWVDEDVS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtacgtcgcagccatcgaccagggcaccacgagcacccggtgcatgctcttc
gaccacgacggggcggtcgtctccgtgggccagaaggagcacgagcagatcttcccgcgg
gccggctgggtcgagcacgacccgatggagatctggaccaacacccgggaggtcgtcggg
caggccctcgcccgcggcaacgccagcaactccgacatcgtcgccgtcggcatcaccaac
cagcgcgagaccaccgtcgtctgggacaggaccaccggccggccggtctacaacgcgatc
gtctggcaggacacccgcaccacggccatcgtcgagcagctcggggcgctcggcggcggc
gcggaccggtacaaggacaaggtgggcctgccgctggcgacctacttcgccggccccaag
gtgcgctggatcctggacaacgtcgacggcgcccgcgaagccgccgagcgcggtgacctg
ctcatgggcaccatcgactcctggctgatctggaacatgaccggcggcacggacggcggc
ctgcacctcaccgacgtctccaacgcctcccgcacgatgctcatggactaccgcacgctg
gcctgggacgcggccatcgccgaggagatgggcatcccgatgtccatgctcccggagatc
cggtccaactccgaggagtacggggtcggccgcaagtccggcttcctggccggcgtaccg
atcgccggctcgctgggcgaccagcaggcggccaccttcggccaggtctgcttcaccaag
ggcatggccaagaacacctacggcaccggcaacttcatgctgctcaacaccggcgaggag
gccgtcccgtccaagaacggcctgctcacgacgctgtgctaccagctcggtgacgccaag
ccggtgtacgcgctggagggctcgatcgcggtcaccggctcgctggtgcagtgggtccgg
gacaacctcaagatgatctccagcgcgccggagatcgaggacctggcccgcgaggtcgac
gacaacggcggttcctacttcgtgccggcgttctccgggcttttcgcgccgcactggcgg
tccgacgcccgcggcgccgtcgtggggctgacccggttcgtcaaccgcggtcacctggcc
cgcgccgtcctggaggccacggcctaccagacccgcgaggtgctcgacgcgatgaacgcc
gactccggcgtcgacctcaccgagctgcgggtggacggcgggatggtcggcaacgagctg
ctcatgcagttccaggccgacatcctcgacgtcccggtgatccggccgaagatcgccgag
acgacggcgctgggcgcggcctacgcggccgggctggcagtcggcttctggtccgacctc
gacgagctgaccgcgaagtgggccgaggacaagcgctgggagccgcagatggccaccgag
gaccgggagcggtactaccgcaactggcagaaggcggtcaccaagagcctcgactgggtg
gacgaggacgtcagctga

DBGET integrated database retrieval system