KEGG   Methanosarcina mazei Tuc01: MmTuc01_0096Help
Entry
MmTuc01_0096      CDS       T02477                                 

Definition
AMP phosphohydrolase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmaz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96493..98016)
Genome map
AA seq 507 aa AA seqDB search
MMQLKLEHYNIKIGQHKVLLNIVDAKELGVNPGDRVRIRGHQSLSAIVDTTDDMVPPGTL
GVFTEVYEHFEDWDKPVEVVPSFRSKSAAVIKKMLDKKPVVQDEIKMLVSDIVDENLSDV
ELSAFITASYIHGMTDDEVEWLTRAMIDTGDTIEFLTHPIMDKHSIGGVPGNKISLLIVP
IVAANGLLIPKTSSRAITGAGGTADLMEVLSPVEFSSQEVKEITEKVGGALVWGGATNIA
PADDKLIKIEYPLSIDPYYQMLASIMAKKGAIGADNVVMDIPVGPGTKVPTVQEGQKLAR
DLINLGHRLGMNVECAITYGSSPIGRRVGPSLEVKEAMKVLESMEGPNSLIEKSAALAGI
LLEMGGAAPRDQGKELALETLRSGKALEKMKQIIEAQGGDPNIKSDDIQTGQYTADIFAS
TDGYVMEFDNKWIIEIARLAGAPNDKGAGVAIHKKRGEQVKKGDPILTIYAEKEIKLDNA
LATAQRTNPIIVEGMLLRRIPGTYGFQ
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcagttgaagctggaacattataatataaaaattggacagcacaaagtgttgctg
aatattgtcgatgcgaaagaactgggagtcaaccccggagatagggtccgcatccggggg
catcaaagcctttctgccattgtggacacaactgatgacatggttcctccgggaactctt
ggtgtctttactgaagtttatgaacatttcgaagactgggataagccggtagaagttgtc
ccttcttttcgctcaaaatccgcagccgttatcaaaaaaatgctggacaaaaagcctgtt
gtacaggacgagatcaaaatgcttgtaagcgatatcgttgatgaaaacctgagcgatgtc
gagctttctgcctttataacagcttcatatatccacgggatgaccgatgacgaagtcgaa
tggctgacaagggcaatgatagatacaggagacactatcgaattcctaacgcaccctatt
atggacaagcactcgataggtggggttcccggaaacaagatttctctccttattgtcccc
atagttgccgcaaacgggctgctcatcccaaagaccagttcaagggctatcacgggtgca
ggcgggactgccgaccttatggaagtgctctctcctgttgagttcagctcgcaggaagta
aaggagataaccgaaaaggtaggaggagcactcgtctggggcggagctacaaatattgcg
cctgcagatgataagctcatcaaaattgaatatcccctgtccattgacccttattaccag
atgcttgcctcaatcatggcaaaaaaaggagccatcggggcagacaatgtggtaatggat
atccctgtcgggccgggcacgaaggtccccacagttcaggaaggacagaaactggccaga
gacctcatcaacctcgggcacagacttggaatgaatgttgagtgcgctattacttacggt
tcgtctcctatcgggaggagagtaggaccttctctggaagtaaaggaagccatgaaagtc
cttgagagcatggaaggtccaaacagccttattgaaaagagcgcggctctcgcaggcatt
cttcttgaaatgggaggggcagctccgagagatcagggaaaagagcttgcacttgaaact
ctcaggagtggaaaagctctcgagaaaatgaaacagatcattgaagcccagggaggagac
ccgaacatcaagtccgatgatattcagacagggcagtacactgctgatatttttgcttct
acggacgggtatgttatggagttcgacaacaaatggataattgagattgccaggcttgca
ggagctccaaatgacaagggagctggagttgcaatacacaaaaagagaggagaacaggtt
aaaaaaggagatccgattctcaccatatatgccgaaaaagagatcaaacttgataatgca
ctggcaacggcacagaggacaaacccgataatagtcgaaggcatgcttctcagaagaatt
cctggaacttatgggttccagtaa

DBGET integrated database retrieval system