KEGG   Methanosarcina mazei Tuc01: MmTuc01_0315Help
Entry
MmTuc01_0315      CDS       T02477                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MmTuc01_0315
Enzymes [BR:mmaz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MmTuc01_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332946..333737
Genome map
AA seq 263 aa AA seqDB search
MAEEKIPVLAIMRPESYREKSEAIARDYGFEPLCVPMIKLEGIKDDGFEPFIQRVIDGTS
DYVVFTSANGITFTLDKLTEDEKKNFITALKKRKVIAIGPNTEKELVRIGIENSFMPADY
SSEGIVEALCPEVKGKTVDLARSAYGAKLLIDGLEKCGATVYETHVYTLSIPEGAAQKEL
IERTLSGEVDAFAFTSSMMVRGFMKHAENLGASEAVKEILSRAVVGAIGTPTGNTLKKHG
VNANVIPDEFTFEALIKAMKKEF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagagaaaattcccgtgcttgcgatcatgaggccggaaagttaccgcgaaaaa
tccgaagctattgccagggactatggatttgagcctttatgtgtcccgatgataaagctt
gaaggcataaaagatgacggtttcgagccttttattcagagggtcattgacgggacttcg
gactacgttgttttcacaagtgcaaacgggataactttcacactggataaactaacggaa
gatgaaaagaaaaacttcatcacagcccttaaaaaaagaaaagtaatagcaatcggtccc
aacacggaaaaagagcttgtgagaataggaattgagaactccttcatgcctgcggattac
agttccgagggaatcgtagaagctctctgtcctgaagtgaaaggaaaaactgttgacctt
gcaaggagcgcttatggggcaaaactcttaatagacggccttgaaaaatgtggggcaacg
gtttacgagacccatgtatatactctcagcatccctgaaggagcagcccagaaagagctc
atagagcgcaccctttcgggagaggttgacgcctttgcctttacaagctctatgatggtc
aggggatttatgaagcacgcagaaaacctgggagcttcagaagctgtaaaagaaattctc
agcagggctgttgtgggcgcaattgggactccgacaggaaataccctgaaaaaacacggg
gtcaatgcaaacgtgatccctgatgagttcacctttgaagcccttataaaggctatgaag
aaagagttctga

DBGET integrated database retrieval system