KEGG   Methanosarcina mazei Tuc01: MmTuc01_0434Help
Entry
MmTuc01_0434      CDS       T02477                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MmTuc01_0434
  Amino acid metabolism
   00340 Histidine metabolism
    MmTuc01_0434
Enzymes [BR:mmaz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MmTuc01_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(448590..449882)
Genome map
AA seq 430 aa AA seqDB search
MLFKKLSDVSEAEMQRLISRGSGLADVGDTVSAVLSDVRMKGDAALREYTKKFDKVELAN
FEVSEEEFEKALSEIGSELLGHLRIAAENIRAFHRAQMPETTWFMELQPGVVLGQKATPL
ESVGAYAPGGRASYPSTVLMTVIPARVAGVEQVIVCTPPRADGSVHPLTLAAAKVAGADK
VFKLGGVQAIGAMAYGTETVPRVDKIVGPGNVFVTSAKMQVRDIAEIDFPAGPSEVLIIA
DESADAAMAASDIIAQAEHDPNAVSMLVTTSETLAEEVEQEVLAQAESTARSEIVKISLE
NAAVLIADSLDQCIDFSNKFAPEHLEIMVEDSDFVLGRIKNAGSIFIGNYAPVPVGDYAS
GTNHVLPTAGYAKIYSGLNINHFLKYSSIQKISKSGLESLKETVIALAEEEGLKAHADSI
RARFGYRPSK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttattcaaaaagttgtctgatgtttcggaagctgaaatgcagaggttaatttcccgg
gggtccgggcttgcagatgttggagataccgtatcagccgtactttctgacgtgcgcatg
aaaggagatgctgccctcagggagtatacaaaaaagttcgataaagttgaacttgcaaat
tttgaggtaagtgaagaagagtttgaaaaagctctctccgagatcggttcggaactgctt
ggacaccttagaattgcagctgaaaatattcgggctttccacagggctcagatgcctgaa
actacctggtttatggaacttcagcccggggttgtcctcgggcagaaggcaacacccctt
gaaagtgtaggggcttatgctcccggagggagggcttcctatccatcgactgtattgatg
acagtaatccctgccagggttgcaggagttgagcaggttattgtgtgtactcctcccagg
gctgacggttccgtacaccctcttacccttgctgctgcaaaggttgcaggtgcggataag
gttttcaagctcgggggagtgcaggcgataggggctatggcttacgggactgaaaccgtt
cccagggtggacaaaattgtcggtccaggaaatgtttttgtgacctctgcaaaaatgcag
gtaagggatattgctgagattgattttccggcaggcccgagtgaggtccttatcatagca
gacgagtctgcagatgctgctatggctgcttcggatattatagcccaggcagaacatgac
cctaacgcagtttccatgcttgtgacaacttcggaaactcttgcagaagaagtggagcag
gaagtgctcgcccaggccgaaagtactgcaaggagtgaaattgtgaaaatctctcttgaa
aatgcagcagttctgattgcagactctcttgatcagtgcattgactttagcaataaattt
gcacccgagcaccttgaaattatggtagaagattccgattttgtgcttggcagaattaaa
aatgcaggatcgatatttatagggaactatgctcctgttcctgtcggagactacgcttcc
ggtaccaatcatgtgcttcctaccgcagggtatgcgaagatctattccggactgaacata
aatcacttcctcaagtattccagtatacagaaaatcagcaagagtgggcttgaaagtttg
aaagaaactgtaatcgcattagctgaggaagaaggtttgaaggcacatgctgactctatc
agggctcgtttcggatacagaccctctaaataa

DBGET integrated database retrieval system