KEGG   Methanosarcina mazei Tuc01: MmTuc01_0687Help
Entry
MmTuc01_0687      CDS       T02477                                 

Definition
(GenBank) peptidase M42 family protein
Organism
mmaz  Methanosarcina mazei Tuc01
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(670191..671348)
Genome map
AA seq 385 aa AA seqDB search
MEKNTEKGEKLEEIRSLLEKFTNAHGISGFEGEVRKLLEKELEPYVDSMREDIMGNLIAV
KEGKGPSVMLAAHMDEIGLMVRYIDENGFLRFVGIGGWFDQTLLNQRVIVHGKKGSIYGV
IGSKPPHVMKDEDRKKPVKLEDMFIDIGAKDREDAENLGVEIGTSVSIDQEFTTLANGKV
TSKAFDNRAGVVILVRVMKELHERGIEANVYAVGTVQEEVGLKGAKTCTFCICPDVALAL
DTTIPGDHPGISKIDSALELGKGPVITVADASGRGLIAHPQILKWLRETADKNEVPYQLG
VGSGGTTDATSIHLTKEGIPTGTVSIATRYIHSPVEVLDMADIDACVSLIVTAIENLKGR
LHRNSTSRVVSTGLVLCNSLFILTV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaatacggaaaaaggcgaaaagcttgaagaaataagatcccttctcgaaaag
ttcacgaatgctcacggaatttccggctttgaaggcgaagtccggaaactgcttgagaaa
gagcttgagccctatgttgacagtatgcgggaggacattatggggaacctcatcgctgtt
aaagagggcaaaggtccttctgtaatgctggctgctcatatggatgaaatcgggctgatg
gtcagatatattgatgagaacggtttcctgcgctttgtcgggattgggggatggtttgac
cagactcttctgaaccagagagttatcgtgcatggcaaaaagggctccatttatggagtc
atagggtccaaacctcctcatgtgatgaaagatgaggacagaaaaaagcccgtgaaactc
gaggacatgtttatcgatataggggcaaaggacagggaggacgctgaaaatctgggtgtc
gagataggtacttcagtatcaatcgatcaggaattcacgaccctggcaaacggaaaggtt
acctccaaggcttttgataaccgtgcaggagttgtaattctcgtcagagttatgaaagag
cttcatgaacgcgggattgaagcaaatgtctatgctgtcggcacggttcaggaggaagta
gggcttaaaggagcaaaaacctgtactttctgcatctgcccggatgttgcccttgccctt
gacaccaccatccctggagatcatccgggaatcagcaaaatcgattcagccctggaactt
ggaaaaggaccggtgataactgtagcagacgcgtccggaagaggtctcatagcccatccg
cagattctcaaatggctccgggaaaccgccgataaaaatgaggtcccctatcagctgggt
gtaggttctggaggcaccacagacgctacatcaatccacctcaccaaagaaggtatccct
acaggtacggtcagtatagccacacgctacattcactctcctgtagaggttctggatatg
gctgatatagacgcctgcgtttctctcattgtgacggcaatagaaaatttaaaagggcgg
ctgcaccggaacagcaccagtagagttgtatcaacagggctggtgctgtgcaattctctt
tttatacttactgtttaa

DBGET integrated database retrieval system