KEGG   Methanosarcina mazei Tuc01: MmTuc01_0771Help
Entry
MmTuc01_0771      CDS       T02477                                 

Definition
(GenBank) Glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
mmaz00625  Chloroalkane and chloroalkene degradation
mmaz00680  Methane metabolism
mmaz01100  Metabolic pathways
mmaz01120  Microbial metabolism in diverse environments
mmaz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MmTuc01_0771
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MmTuc01_0771
Enzymes [BR:mmaz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MmTuc01_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AGF96179
UniProt: M1QGQ3
Position
complement(744859..746232)
Genome map
AA seq 457 aa AA seqDB search
MLLCICREGEKAGRETSQDWGDFMKAVVYRGPNQVSVEEVEDPKIEHPADAIIRLTSSGI
CGSDLHMYEGRTVEKPGKVLGHEPLGVIEEVGDAVTSFKKGDRVVVTFNIACGHCLNCIR
GFTSACLTVNPESAGGAFGYAKMGPYRGAQAEFLRVPFADLNCTKLPGSPGDKWEDDFIM
LSDVFPTGFFATQLAMVMPGFPVAVFGAGPVGLLFVVDYIPERLKLAKSIGAIPVDFTLS
DPVAMIEALRSQHSRVDTVLPGEEKLQGIMSSIENLAKSIGANLELARSDPVTMIQMLRA
GNPAIVQSLIPGEEKMKGVMSGIDAVGYQARDRQDPSRENPTQVISDLVRLINPTGHLGV
IGVYVADDPGAYNERAKKGEYILPFGQLWEKGISVGTGQTPVKKLQPMLRDMIIAGVAKP
SFIVSHKISIEEAPDAYREFAKRSEGFTKVTNRLVET
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgttgctctgcatatgcagggaaggtgaaaaagctggcagagaaacttcacaggattgg
ggtgattttatgaaagccgttgtttatagagggccgaatcaggtttctgtagaagaagtc
gaagatccgaaaatagagcacccggcagatgccataatcaggcttacttcgagtggcata
tgcggaagcgaccttcatatgtatgaaggaagaactgttgaaaagccgggaaaagttctt
gggcatgagcctctaggggttatagaagaggtgggggatgccgtgacctcttttaagaaa
ggggacagggttgtcgttacttttaacattgcctgcgggcactgtttgaactgtattcgg
ggttttaccagcgcctgcctgactgttaatcccgaaagtgcaggaggagcttttggatat
gccaaaatgggtccttatagaggggctcaggctgaatttttaagggtgccgtttgccgac
ctgaactgtacgaaacttccagggtctccaggggataaatgggaagacgatttcattatg
ctgtcggatgtatttcctacaggtttttttgctacgcagcttgcaatggtaatgccagga
tttcctgtcgcggttttcggggcaggacctgtaggtttgctttttgtcgttgattacatt
cctgagaggctgaagctggcaaagagtattggtgctattcctgtagattttacacttagc
gaccccgtagccatgattgaggcattaaggtctcagcattcgagagtggataccgtgctt
ccgggcgaggaaaaactgcagggaatcatgtccagtatagaaaaccttgccaagagtata
ggtgctaaccttgaactcgccaggagcgatcccgtaactatgattcagatgttgagggca
ggaaaccctgcaattgttcagtccctgattccaggtgaggaaaaaatgaaaggtgtgatg
tccggtatagacgcagtcggatatcaggcaagagacaggcaagatccctcaagggaaaac
ccaacgcaggtgataagtgatctggtgaggcttatcaacccgaccggtcacctgggagtt
atcggggtctacgtggcagatgaccccggagcttataatgaacgcgctaagaaaggggag
tatatcctgccttttggacagctctgggaaaaaggtataagtgtaggaacaggccagact
ccggttaagaaacttcaaccgatgctcagggatatgataattgcaggcgtggcaaagcca
agctttatagtaagtcacaaaatctccatagaggaagcgcctgatgcctacagggagttt
gccaaacgctcagaaggctttacaaaggtaactaacaggctggttgaaacctaa

DBGET integrated database retrieval system