KEGG   Methanosarcina mazei Tuc01: MmTuc01_1598Help
Entry
MmTuc01_1598      CDS       T02477                                 

Definition
Ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmaz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1583870..1584457
Genome map
AA seq 195 aa AA seqDB search
MALFLYISLKMWQEMAKYGRKLVEHGLVESNFGNISVRAGDRMVITRSGTALDEITGDNI
VEVGIRDTSSLDMIASSEAVVHREIYRRTSVLAIIHAHCPYSVVESLLAGPGNVIVPVDS
EGQYFLGDIPVVGGGIGSSELAKNLADSLSGHRGAVVFSHGTFATGRTLGEAYIVTTQLE
HSCRVKYLYDLAVQK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcactctttctctatatctcgcttaagatgtggcaggaaatggcaaaatacgggcgc
aagctggttgaacatgggcttgtggaatcaaattttggaaatatcagcgtcagggcaggg
gacagaatggtcattacccggagcgggaccgcacttgacgagatcaccggtgataatatt
gttgaggttggcatccgggatacctcgtccctggacatgattgcgtcttccgaagccgtg
gtacacagggagatctacaggaggacttctgtccttgcaataattcatgcacactgccct
tattcggtggttgaatccctgcttgccggtcctggcaatgtaattgttcccgtagacagt
gagggccagtatttccttggagatattccggttgtgggaggaggaatcggaagctcagag
cttgcgaaaaaccttgcagattcgctttccgggcacaggggagctgtagtattcagccac
ggtacctttgccacagggagaacgttaggtgaagcttatattgtgaccacgcagcttgag
cactcctgcagagtgaaatacctgtacgaccttgcagtacaaaagtga

DBGET integrated database retrieval system