KEGG   Methanosarcina mazei Tuc01: MmTuc01_1598Help
Entry
MmTuc01_1598      CDS       T02477                                 

Definition
Ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MmTuc01_1598
Enzymes [BR:mmaz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MmTuc01_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1583870..1584457
Genome map
AA seq 195 aa AA seqDB search
MALFLYISLKMWQEMAKYGRKLVEHGLVESNFGNISVRAGDRMVITRSGTALDEITGDNI
VEVGIRDTSSLDMIASSEAVVHREIYRRTSVLAIIHAHCPYSVVESLLAGPGNVIVPVDS
EGQYFLGDIPVVGGGIGSSELAKNLADSLSGHRGAVVFSHGTFATGRTLGEAYIVTTQLE
HSCRVKYLYDLAVQK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcactctttctctatatctcgcttaagatgtggcaggaaatggcaaaatacgggcgc
aagctggttgaacatgggcttgtggaatcaaattttggaaatatcagcgtcagggcaggg
gacagaatggtcattacccggagcgggaccgcacttgacgagatcaccggtgataatatt
gttgaggttggcatccgggatacctcgtccctggacatgattgcgtcttccgaagccgtg
gtacacagggagatctacaggaggacttctgtccttgcaataattcatgcacactgccct
tattcggtggttgaatccctgcttgccggtcctggcaatgtaattgttcccgtagacagt
gagggccagtatttccttggagatattccggttgtgggaggaggaatcggaagctcagag
cttgcgaaaaaccttgcagattcgctttccgggcacaggggagctgtagtattcagccac
ggtacctttgccacagggagaacgttaggtgaagcttatattgtgaccacgcagcttgag
cactcctgcagagtgaaatacctgtacgaccttgcagtacaaaagtga

DBGET integrated database retrieval system