KEGG   Methanosarcina mazei Tuc01: MmTuc01_2055Help
Entry
MmTuc01_2055      CDS       T02477                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmaz  Methanosarcina mazei Tuc01
Brite
Enzymes [BR:mmaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MmTuc01_2055
Transfer RNA biogenesis [BR:mmaz03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MmTuc01_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2028633..2030378)
Genome map
AA seq 581 aa AA seqDB search
MNPSLEPDYKFRLRISVADATERAWNMTLKTEFEMKEADYNRACRNILEKVLAGEIKDED
QLNKVKKDVSKLYHLASLPRNGDIIMQGTPEEQALIKEFLRRKPVRTISGVAVIAVMTSP
APCPHGVCLPCPGGPNSSFKSPQSYMGREPAAMRAIQHEFDPYSQVQSRLSQLKEIGHDV
EKVELIVMGGTFSARSLDYQEWFTKRCLEAMNDFTGMEWRDKAWTIGKSLPYVPLEEVQK
ANETADIRNVGITFETRPDWAREEHVDEFLRLGGTKVELGVQSVYDFVLSRMQRGHGVAE
IVRANRVLRDSAFKVGFHMMPHLPGADSELDLRGFKKLFDDQRFRPDYLKIYPTLVTEGT
PLYRMWKSGEYQALSDEEAAELVADIKAVLPKWVRLQRIQRDIPAHQIFAGVRKSNLRQL
AEEKLREKGGKCRCIRCREVGHNSLKGRRINEKDIELTVESYEACNGKEHFIAFEDLSAD
VLIGFTRLRFPAEPHREELQGSALIRELHVYGSMVPVGKGAKQKEWQHRGYGKELIEHAE
KMASEFGYSKLSIISGIGAREYYRKLGYDLDGVYMSKALKD
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctccctggaacctgattacaagttcaggttaaggatttcagttgcagatgcc
actgaaagagcctggaatatgaccctaaagacggaatttgagatgaaagaagctgattac
aacagggcctgcaggaacatccttgaaaaggtgcttgccggggaaataaaagacgaagac
cagttaaacaaagtgaaaaaagatgtgagtaagctgtatcatcttgccagcctgcctaga
aatggggatattattatgcagggcacacctgaggagcaggctctaataaaagagttcctc
aggagaaaacccgtaaggacgatttccggagtcgcggtaattgctgtaatgacctctcct
gccccatgccctcatggggtttgcctgccctgtccgggaggtccgaattcctcatttaaa
tcccctcagagctacatgggaagggaacctgcagcaatgagagcaattcagcatgaattt
gacccttactcccaggttcagtccaggctttcccagctaaaagagatagggcatgatgtt
gaaaaagttgagcttatagtgatgggaggcactttttcagcacgcagccttgactatcag
gaatggtttaccaaacgctgtcttgaagcaatgaacgattttacaggcatggaatggagg
gataaagcctggacgatcggaaagtccttgccttatgttccgctcgaagaggttcagaaa
gcaaacgaaacagctgacatccgaaacgttggcataacctttgagacaagacctgattgg
gcaagagaagaacatgtggacgaattcctcaggcttggagggacaaaggtagagcttgga
gtccagagcgtttatgattttgtattatcccggatgcagagagggcatggagttgcagaa
attgtcagagctaacagggtattaagagacagtgcatttaaagtaggctttcacatgatg
cctcaccttcctggagcggactccgaacttgacctgaggggatttaaaaagctcttcgat
gaccagcgtttcaggccggattacctgaaaatatatcctacccttgtaaccgaaggcacc
cccctgtacagaatgtggaaatccggagaatatcaggctctttcagacgaagaagctgca
gaacttgtcgcagatataaaggctgtcctgcctaaatgggtaaggcttcagcgcatccag
agggatattcctgcccaccagatctttgcaggcgtgaggaaaagtaacctaaggcagctt
gcagaggagaaactccgggaaaagggagggaaatgccgctgcatacgctgcagagaggtc
ggacacaacagcctgaaaggaagaaggataaatgaaaaagacatcgagcttactgtggaa
tcttacgaagcctgtaacggtaaagaacacttcatcgcttttgaagacctttcggcagat
gtcctgataggttttacacgtttgcgtttccctgccgaacctcacagagaagaactgcag
ggctctgcacttataagggaactgcatgtttacggctccatggtgcctgtaggaaaaggc
gcaaaacaaaaagaatggcaacacaggggttatggaaaggaacttattgaacatgcagaa
aaaatggcatccgaattcggctacagcaagctttctataattagcggaataggcgcaagg
gaatattataggaaactgggatacgatcttgacggagtatacatgtcaaaagccctgaag
gattaa

DBGET integrated database retrieval system