KEGG   Methylotenera mobilis: Mmol_0045Help
Entry
Mmol_0045         CDS       T00942                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mmb  Methylotenera mobilis
Brite
Enzymes [BR:mmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mmol_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
48962..49651
Genome map
AA seq 229 aa AA seqDB search
MTQTAKAVESAQFNIGEARFNMIEQQIRTWEVLDPVVLAVLDAVPREKFVAESQVGLAFA
DVELPIGEGQTMLSPKLEGRILQALNIKKTDKVLLVGTGSGYLAALLATLAQHVHAVEIY
PTLSNAAQYRLQAQGIHNTTLYVADGVNGFAAAAPYDVIVFAGSLPLRPLAAEKMLNVGG
RLFAVVGESPIMEATVTERVGETSFRHETIFETCLPVLENAPQASKFAF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacagctaaagcagtagaaagtgctcaattcaacatcggtgaagctagattt
aacatgattgagcagcagattcgtacttgggaagtgttagaccctgtggtactagcggtg
ctagatgcagtgccacgtgagaagtttgttgcagagtctcaagtgggcttagcctttgca
gatgtggagctgcctatcggtgaaggccaaaccatgctgtcacctaagttggaaggacgc
attctgcaggcgctaaatattaaaaagaccgataaagtattgctagtgggtaccggtagc
ggctatctggctgcgttgctggctactttggcgcagcatgtacatgcggttgaaatttat
ccaacgctatctaatgcagcgcaataccgtttgcaggcgcagggcatccataacacgact
ttatacgtagctgatggtgtaaatggctttgcagctgccgcaccgtatgatgtgattgtg
tttgctggctctttgccgttgcgtccgttggcggcagaaaaaatgctcaatgttggcggc
aggttatttgctgtagtgggtgagtcgccaattatggaagcaaccgtgaccgagcgcgtg
ggcgaaacttccttccgccatgaaacgatttttgaaacctgcttgccagtgttggaaaat
gcgccacaagctagcaagtttgctttttaa

DBGET integrated database retrieval system