KEGG   Methylotenera mobilis: Mmol_0165Help
Entry
Mmol_0165         CDS       T00942                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00860  Porphyrin and chlorophyll metabolism
mmb01100  Metabolic pathways
mmb01110  Biosynthesis of secondary metabolites
mmb01120  Microbial metabolism in diverse environments
Module
mmb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmol_0165
Enzymes [BR:mmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mmol_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 LpxK Creatinase_N
Motif
Other DBs
NCBI-ProteinID: ACT47075
JGI: Mmol_0165
UniProt: C6WYV0
Position
complement(177500..178276)
Genome map
AA seq 258 aa AA seqDB search
MRTDHLLSNLHIAVTRPLDQAESLNLAIAQHGGSAISFPLLAIAALDDYQAFEQQLDRVS
RTDWAIFISSNAVDYAMPRLIKKFGKIPGHLKFAAIGHQTAKALAQYGAHQVLVPHTRFD
SETLLALPELQDVSAQTIAIFRGVGGRELMADTLKARGADVYFAESYRRINPQHNADLLA
AQWRQNQLDAVIVTSSEAMRYLLQLAAHAEWLTHVTLCVNHERIAEQPRQLGLKVLVASA
PGDEAMLQCLAQLVKHHD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccgaccatctattgagcaacttacatattgcggtcacccgaccgctagaccag
gcagagagtttgaaccttgccattgcccagcatggcggtagcgcaatctctttccccttg
ctggcgattgccgccttggatgattatcaagcgtttgagcaacagctcgaccgcgtcagc
cgcacggactgggcgattttcatcagctccaatgcggtggactacgccatgccgcgttta
atcaaaaaattcggcaagattcctgggcatttaaagtttgccgcgataggccaccagacc
gcaaaagccctggcgcagtatggtgcacaccaagtactggtgccgcacacccgttttgac
agcgaaactttactggcgctaccggagctgcaagacgtttcagcccaaaccatcgccata
tttcgcggtgtaggcggccgcgaactaatggcagacacgctgaaagccagaggcgccgac
gtttatttcgcggaaagctaccgtcgcatcaatccgcagcacaatgcagacctgctggca
gcgcaatggcgccaaaaccaactggacgcggttatcgttaccagcagtgaagccatgcgc
tacttgctacaactggccgcgcacgcagaatggttaacgcatgttacattatgcgtaaat
catgagagaatcgcagagcagcctaggcagctaggcttaaaagtactggtcgccagcgca
cccggagatgaagccatgctgcaatgcctggcacaacttgtaaaacatcatgactaa

DBGET integrated database retrieval system