KEGG   Methylotenera mobilis: Mmol_0183Help
Entry
Mmol_0183         CDS       T00942                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00230  Purine metabolism
mmb01100  Metabolic pathways
Module
mmb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mmol_0183
Enzymes [BR:mmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mmol_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 CPT MMR_HSR1 AAA_23 AAA_22 ABC_tran cobW AAA_18 AAA_16 RsgA_GTPase MobB POTRA_1 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ACT47093
JGI: Mmol_0183
UniProt: C6WYW8
Position
195213..195824
Genome map
AA seq 203 aa AA seqDB search
MVPGNLFIITAASGAGKTSLIKALLAEDTHLKLSISHTTRKPRPGEQDGVDYHFVDDAMF
LQMLGEAKFLESAEVHGARYGTSQSAVDAPLQAGHDVILEIDWQGAAQVRRLFPNAISIF
VLPPSIETLEQRLNSRGQDSQETISKRVAAARAEMRHVSEFDYVTINHYFDVALQDIRAI
IRAQRLVGAAQLQRYGSLIQALT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggttccaggtaatctttttatcatcaccgcagcgtctggcgcaggtaaaaccagccta
attaaggccttgcttgctgaagatacgcatttgaaactatctatctcgcacactacgcgc
aagccgcgccctggtgagcaagatggtgttgattatcattttgtggatgatgctatgttc
ttgcagatgctgggcgaagcaaaattcttagaaagcgcagaggtgcacggtgcgcgctac
ggtacttcgcagtctgccgtagatgcgccgttgcaagctgggcatgatgtgattctggag
attgactggcagggtgcggcacaagtgcgtcgcctgtttcctaatgccatcagtatcttt
gtattgccgccttctatcgagacgctggaacagcgcttgaatagccgcggacaggatagc
caagagactatatccaaacgcgttgccgctgcgcgtgctgaaatgcgccatgtgagcgag
ttcgattatgttacaattaaccactattttgacgtagcgttgcaggacattcgcgctatc
atccgcgcccagcgtttagttggtgccgcacagttgcaacgttatggcagtttaattcaa
gcgcttacttaa

DBGET integrated database retrieval system