KEGG   Methylotenera mobilis: Mmol_0260Help
Entry
Mmol_0260         CDS       T00942                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mmb  Methylotenera mobilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmol_0260
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mmol_0260
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmol_0260
Enzymes [BR:mmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Mmol_0260
Exosome [BR:mmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmol_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
290612..292147
Genome map
AA seq 511 aa AA seqDB search
MRIVNRLSLIMLTVACVVGSVSAMAENAQTWINDGEAALAAAKKLHPELGRAKNVILFVG
DGMGISTITASRIFEGQSKGLDGERNQLAFERLPYLALSKTYSANQQTSDSAPTMTAIVT
GVKTNDGGLSVNQAVVRSEPSHAVIQANKLTTILEQAEMSGRATGIISTARVTHATPAAT
YAHTSNRDWEADSNLPAGADVKDIAAQLIDSFGPKQIGDGLEVLMGGGRSNLLPKAQSDP
EYPNIKGKRNDGRDLIQEFQTKFNAHYVWNKAQFDAFNPASGQRLLGLFEPSHMQYDHDR
LTDTAGEPSLAEMTDKAIEVLKRNKKGYFLMVEAGRIDHASHANNAFRTLSETVALSDAV
KLAMSKVDMRDTLIIVTADHSHTLTIGGYAKRGNPILGKVIFPGAAVPEKALDGNPYTTI
SFANGTGYAAGGDAHSASASRAGRVADMSTVDTEDPDFHQEVMVPLAAETHAGEDVAIFA
GGPNAHLFHGIQEQSYIYYVMEDAMGLATRR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaatagtgaataggttaagtttgatcatgctcacagtggcatgtgtcgttggtagc
gtatcggccatggcggaaaatgcacagacctggattaatgacggagaagcggcactagcc
gcggccaagaagctgcatcctgaattggggcgtgctaaaaacgtgatattgtttgttggg
gatggtatggggatttctaccatcaccgcgtcacgtatttttgaagggcagagtaagggc
ctggacggtgaacgcaaccagctggcattcgagcgtttgccttatttggcgctttccaaa
acctattcggccaaccagcagacttccgattctgcacctaccatgactgcgatagtgacc
ggtgtcaaaactaatgatggtgggttgtcagtcaatcaagctgttgtacggtctgaaccc
agtcatgctgtgattcaagcaaataaattaaccaccatactagagcaggcagaaatgagc
ggccgcgctaccggtattatctccactgctcgtgttactcatgccacgcctgctgccaca
tatgcgcacaccagtaatcgcgattgggaggcggacagcaacctgcctgcgggggctgat
gtaaaggatattgccgcgcagttgatagatagctttgggccgaagcaaattggtgacggt
ctggaggtgttgatgggcggcggtcgcagtaatttattgcctaaagcacagagcgacccc
gaataccctaacattaaaggcaagcgtaatgatgggcgagatttaatacaggagtttcaa
actaaatttaatgcacactacgtgtggaacaaggcgcagtttgatgcgtttaaccccgcc
agtgggcagcggcttctgggtttgtttgagccgtcacatatgcaatatgatcatgaccgc
ctaaccgataccgcaggtgagccgtccctcgcagaaatgacggataaggcgatagaggtg
ctaaagcgcaacaaaaaagggtatttcctgatggtagaggccggccgtatcgaccacgcg
tcgcatgccaacaatgccttccgtaccttgagtgaaactgttgcactgtctgatgcggtt
aagctagcgatgagcaaggtcgatatgcgcgatacactgattatcgtgacggcagatcat
agccatacgctgactatcggtggttatgcgaaacgcggtaaccccatattaggcaaggtg
atctttccgggggctgctgtgccagagaaagcattagatggtaacccttacactaccatc
agttttgccaatggtacaggttatgcagctggtggcgatgcgcattctgcatcagcctca
cgggctggtcgtgtggcagatatgagcacagtggataccgaagacccagactttcaccaa
gaagtgatggtgccgctagccgctgaaacgcatgcaggtgaggatgtggccatttttgcc
ggcggccctaatgcacacttgtttcatggcatacaagaacaaagctacatttactacgtg
atggaagacgcgatggggcttgcaactaggcgttag

DBGET integrated database retrieval system